PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_4BL_00160D0BD.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | FAR1 | ||||||||
Protein Properties | Length: 46aa MW: 5573.28 Da PI: 9.0415 | ||||||||
Description | FAR1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | FAR1 | 37.5 | 7.5e-12 | 4 | 45 | 1 | 42 |
FAR1 1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkre 42 +fYn+YA e GFsvrks+ + n+ i+ r+ vCs++g+re Traes_4BL_00160D0BD.1 4 EFYNKYALEKGFSVRKSYVEWDGSNKYIILRKIVCSRQGFRE 45 6***************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03101 | 1.5E-9 | 4 | 45 | IPR004330 | FAR1 DNA binding domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 46 aa Download sequence Send to blast |
EGYEFYNKYA LEKGFSVRKS YVEWDGSNKY IILRKIVCSR QGFRED |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG670306 | 2e-70 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020188780.1 | 5e-24 | protein FAR1-RELATED SEQUENCE 5-like | ||||
TrEMBL | A0A446RF00 | 6e-23 | A0A446RF00_TRITD; Uncharacterized protein | ||||
TrEMBL | A0A453JUJ9 | 4e-22 | A0A453JUJ9_AEGTS; Uncharacterized protein | ||||
STRING | Traes_7AL_5585F9BD1.1 | 4e-26 | (Triticum aestivum) |
Publications ? help Back to Top | |||
---|---|---|---|
|