PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_3DL_F1DB969A8.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

MYB_related

Protein Properties

Length: 161aa MW: 17654.8 Da PI: 9.1898

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_3DL_F1DB969A8.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	43.1	1e-13	55	99	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +W++eE+ l++ + ++lG+g+W+ I+r ++Rt+ q+ s+ qk+ Traes_3DL_F1DB969A8.1 55 PWSEEEHRLFLVGLEKLGKGDWRGISRSYVTTRTPTQVASHAQKF 99 8******************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.403	48	104	IPR017930	Myb domain
SuperFamily	SSF46689	1.64E-17	49	105	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	1.8E-17	51	103	IPR006447	Myb domain, plants
Gene3D	G3DSA:1.10.10.60	2.7E-10	52	95	IPR009057	Homeodomain-like
SMART	SM00717	8.5E-10	52	102	IPR001005	SANT/Myb domain
CDD	cd00167	5.37E-10	55	100	No hit	No description
Pfam	PF00249	5.2E-11	55	98	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 161 aa Download sequence Send to blast
CLQLAVAPSS IVSPSSSSSS SVLLSIDEGL ERASNGYLSD GPHGRLVQER KKGVPWSEEE 60 HRLFLVGLEK LGKGDWRGIS RSYVTTRTPT QVASHAQKFF LRQSSMGKKK RRSSLFDMVP 120 ICENGIRVSE PLTNNGEGAS TSLPRYKSPD MSIDLNSTQE D

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	107	111	KKKRR

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor (PubMed:23888064, PubMed:24806884). Direct regulator of the transcription of peroxidase (Prxs) and reactive oxygen species (ROS)-related genes via the recognition of 5'-ATCACA-3' motif (PubMed:24806884). Binds to 5'-TATCCA-3' motif (TA box) and represses the activity of corresponding promoters (e.g. sugar response genes) (PubMed:25920996). Regulates hypocotyl elongation in response to darkness by enhancing auxin accumulation in a phytochrome-interacting factor (PIF) proteins-dependent manner. Promotes lateral roots formation (PubMed:23888064). Promotes cell expansion during leaves development via the modulation of cell wall-located Prxs (PubMed:24806884). Plays a critical role in developmentally regulated and dark-induced onset of leaf senescence by repressing the transcription of several genes involved in chloroplast function and responses to light and auxin. Promotes responses to auxin, abscisic acid (ABA), and ethylene (PubMed:25920996). {ECO:0000269\|PubMed:23888064, ECO:0000269\|PubMed:24806884, ECO:0000269\|PubMed:25920996}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Slightly induced by CdCl(2) (PubMed:16463103). Accumulates in the dark (PubMed:23888064, PubMed:25920996). Diurnal expression pattern with maximal levels in the morning (at protein level). Specifically induced during leaf expansion (PubMed:24806884). Expressed in old and dark-treated leaves (PubMed:25920996). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:23888064, ECO:0000269\|PubMed:24806884, ECO:0000269\|PubMed:25920996}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JF951923	0.0	JF951923.1 Aegilops speltoides clone TaMYB40 MYB-related protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020184061.1	4e-97	transcription factor SRM1-like
Swissprot	Q9LVS0	9e-39	KUA1_ARATH; Transcription factor KUA1
TrEMBL	A0A3B6GWL0	1e-112	A0A3B6GWL0_WHEAT; Uncharacterized protein
STRING	Traes_3DL_F1DB969A8.1	1e-114	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP4932	30	66

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G47390.1	1e-40	MYB_related family protein

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Liu C,Wang B,Li Z,Peng Z,Zhang J TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth. Plant Physiol., 2018. 176(1): p. 742-756 [PMID:29122985]