PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3DL_4D42B475B.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 101aa MW: 11239.2 Da PI: 9.2836 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 31.4 | 4.3e-10 | 14 | 53 | 1 | 40 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40 rg+WT+ Ede+lv +++ +G g W + +++ g +t+ ++ Traes_3DL_4D42B475B.2 14 RGAWTAMEDEILVSYINDHGEGKWGSLPKRAGRLLTPSSL 53 89******************************77887766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 9.7E-11 | 5 | 43 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 6.47E-7 | 8 | 45 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 7.12 | 9 | 46 | IPR017877 | Myb-like domain |
Pfam | PF00249 | 4.7E-7 | 14 | 52 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.16E-5 | 16 | 45 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 101 aa Download sequence Send to blast |
MGRKPCCAKE GLNRGAWTAM EDEILVSYIN DHGEGKWGSL PKRAGRLLTP SSLIYALLRT 60 LHQYIQLSIM RAIFFKSIDI SSKLFLAIAT ETKSVCVCAY A |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB191460 | 1e-168 | AB191460.1 Triticum aestivum Tamyb10-D1 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
STRING | Traes_3DL_4D42B475B.2 | 6e-70 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP38014 | 2 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49330.1 | 4e-18 | myb domain protein 111 |
Publications ? help Back to Top | |||
---|---|---|---|
|