![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3AS_E65C48107.1 | ||||||||
Common Name | TRAES_3BF059600070CFD_c1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 53aa MW: 5982.65 Da PI: 9.3673 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 42.6 | 1.4e-13 | 13 | 53 | 1 | 41 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqck 41 +g W++eEde+l+ ++++G tW+++a+ g++R++k+c+ Traes_3AS_E65C48107.1 13 KGLWSPEEDERLYTRITRHGVSTWSSVAQLAGLRRSGKSCR 53 678*************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.12 | 8 | 53 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.8E-10 | 10 | 53 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.1E-13 | 12 | 53 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 4.4E-11 | 13 | 53 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.84E-6 | 16 | 53 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 53 aa Download sequence Send to blast |
DVGGEVEAHK ERKGLWSPEE DERLYTRITR HGVSTWSSVA QLAGLRRSGK SCR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Possible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG670306 | 4e-69 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020183575.1 | 6e-30 | myb-related protein 305-like | ||||
Swissprot | P20027 | 1e-15 | MYB3_HORVU; Myb-related protein Hv33 | ||||
TrEMBL | A0A3B6EF32 | 1e-28 | A0A3B6EF32_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A3B6GR81 | 1e-28 | A0A3B6GR81_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A446N5J6 | 1e-28 | A0A446N5J6_TRITD; Uncharacterized protein | ||||
TrEMBL | A0A453E366 | 1e-28 | A0A453E366_AEGTS; Uncharacterized protein | ||||
TrEMBL | A0A453E3A2 | 3e-30 | A0A453E3A2_AEGTS; Uncharacterized protein | ||||
STRING | Traes_3AS_E65C48107.1 | 9e-31 | (Triticum aestivum) | ||||
STRING | Traes_3B_3431FB444.1 | 3e-29 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP21121 | 6 | 6 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G12720.1 | 2e-17 | myb domain protein 67 |
Publications ? help Back to Top | |||
---|---|---|---|
|