PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3AL_730255B9F.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 94aa MW: 10387.8 Da PI: 8.5089 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 88.6 | 1.7e-27 | 46 | 88 | 117 | 159 |
YABBY 117 rPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaakn 159 PekrqrvPsaynrfik+eiq ika+nPdi+hreafsaaakn Traes_3AL_730255B9F.1 46 SDPEKRQRVPSAYNRFIKDEIQHIKANNPDITHREAFSAAAKN 88 57****************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47095 | 6.55E-7 | 37 | 86 | IPR009071 | High mobility group box domain |
Pfam | PF04690 | 1.9E-26 | 43 | 88 | IPR006780 | YABBY protein |
CDD | cd00084 | 1.75E-4 | 53 | 80 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 94 aa Download sequence Send to blast |
IDCIWTSSGK GLHSSVKICA CFFGMEPTRC TSFTNCSSTL PGSNLSDPEK RQRVPSAYNR 60 FIKDEIQHIK ANNPDITHRE AFSAAAKNVV LQVN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Seems to be associated with phloem cell differentiation. {ECO:0000269|PubMed:17676337}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP099409 | 8e-47 | FP099409.1 Phyllostachys edulis cDNA clone: bphylf026i14, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018685707.1 | 7e-20 | PREDICTED: protein YABBY 4-like isoform X2 | ||||
Swissprot | A2X7Q3 | 1e-19 | YAB4_ORYSI; Protein YABBY 4 | ||||
Swissprot | Q6H668 | 1e-19 | YAB4_ORYSJ; Protein YABBY 4 | ||||
TrEMBL | A0A3L6EH37 | 2e-20 | A0A3L6EH37_MAIZE; Protein YABBY 4 | ||||
STRING | Traes_3AL_730255B9F.1 | 3e-65 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1394 | 37 | 121 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G26580.2 | 3e-21 | YABBY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|