![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3AL_58F294736.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 126aa MW: 14256.2 Da PI: 10.6442 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 47.5 | 3.9e-15 | 59 | 101 | 5 | 47 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 +r++r++kNRe+A rsR+RK+a++ eLe+kv Le+eN++Lkk Traes_3AL_58F294736.2 59 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLKK 101 69***************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.6E-13 | 55 | 113 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.702 | 57 | 102 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 2.06E-12 | 59 | 103 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 1.1E-15 | 59 | 102 | No hit | No description |
Pfam | PF00170 | 1.6E-13 | 59 | 102 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14707 | 3.16E-24 | 59 | 104 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 62 | 77 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 126 aa Download sequence Send to blast |
MPIQFVPQPL NVVGPGATLG SAYSDGQSTS PMISPISDSQ TPGRKRGVSG DVPNKFVERR 60 QKRMIKNRES AARSRARKQA YTNELENKVS RLEEENERLK KQKVFSFQYK FTEMPHFSVE 120 VGLPDK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK373919 | 1e-149 | AK373919.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3047H22. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020190743.1 | 3e-63 | ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1 | ||||
Refseq | XP_020190744.1 | 3e-63 | ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1 | ||||
Swissprot | Q9LES3 | 9e-31 | AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
TrEMBL | A0A446NSY0 | 1e-85 | A0A446NSY0_TRITD; Uncharacterized protein | ||||
STRING | Traes_3AL_58F294736.2 | 5e-88 | (Triticum aestivum) | ||||
STRING | Traes_3B_5D3F7382A.1 | 1e-85 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2707 | 38 | 83 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G56850.1 | 4e-33 | ABA-responsive element binding protein 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|