![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3AL_4769A72F1.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 57aa MW: 6558.66 Da PI: 9.3069 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 58.7 | 1.1e-18 | 1 | 38 | 22 | 59 |
EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 22 rsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 rsYYrCt+++C+vkk+v+r a+d+ +v++tYeg Hnh+ Traes_3AL_4769A72F1.1 1 RSYYRCTHPTCNVKKQVQRLAKDTAIVVTTYEGVHNHP 38 9************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03106 | 2.8E-13 | 1 | 38 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.22E-14 | 1 | 39 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 1.3E-15 | 1 | 38 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 16.375 | 1 | 40 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.7E-9 | 1 | 39 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 57 aa Download sequence Send to blast |
RSYYRCTHPT CNVKKQVQRL AKDTAIVVTT YEGVHNHPCE KLMEALGPIL KQLQFLS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG670306 | 3e-88 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020179077.1 | 1e-35 | probable WRKY transcription factor 56 | ||||
Swissprot | Q8VWQ4 | 1e-29 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
Swissprot | Q9FFS3 | 7e-30 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
TrEMBL | A0A3B6EMB5 | 2e-34 | A0A3B6EMB5_WHEAT; Uncharacterized protein | ||||
STRING | MLOC_54950.1 | 7e-35 | (Hordeum vulgare) | ||||
STRING | Traes_3AL_4769A72F1.1 | 6e-36 | (Triticum aestivum) | ||||
STRING | TRIUR3_07596-P1 | 5e-35 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1100 | 38 | 133 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G41570.1 | 3e-32 | WRKY DNA-binding protein 24 |
Publications ? help Back to Top | |||
---|---|---|---|
|