PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AL_4769A72F1.1
Organism
Triticum aestivum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 57aa    MW: 6558.66 Da    PI: 9.3069
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AL_4769A72F1.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY58.71.1e-181382259
                           EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY 22 rsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                           rsYYrCt+++C+vkk+v+r a+d+ +v++tYeg Hnh+
  Traes_3AL_4769A72F1.1  1 RSYYRCTHPTCNVKKQVQRLAKDTAIVVTTYEGVHNHP 38
                           9************************************8 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031062.8E-13138IPR003657WRKY domain
SuperFamilySSF1182901.22E-14139IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-15138IPR003657WRKY domain
PROSITE profilePS5081116.375140IPR003657WRKY domain
SMARTSM007742.7E-9139IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 57 aa     Download sequence    Send to blast
RSYYRCTHPT CNVKKQVQRL AKDTAIVVTT YEGVHNHPCE KLMEALGPIL KQLQFLS
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703063e-88HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020179077.11e-35probable WRKY transcription factor 56
SwissprotQ8VWQ41e-29WRK56_ARATH; Probable WRKY transcription factor 56
SwissprotQ9FFS37e-30WRK24_ARATH; Probable WRKY transcription factor 24
TrEMBLA0A3B6EMB52e-34A0A3B6EMB5_WHEAT; Uncharacterized protein
STRINGMLOC_54950.17e-35(Hordeum vulgare)
STRINGTraes_3AL_4769A72F1.16e-36(Triticum aestivum)
STRINGTRIUR3_07596-P15e-35(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110038133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41570.13e-32WRKY DNA-binding protein 24
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]