PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

MYB

Protein Properties

Length: 142aa MW: 15816.2 Da PI: 10.3437

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_2DL_5A0300CE0.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.6	1.2e-17	15	62	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd+llvd+v+ +g+W+ ++ g++R++k+c++rw +yl Traes_2DL_5A0300CE0.1 15 KGPWTPEEDKLLVDYVQANAPGNWRMLPKLAGLNRCGKSCRLRWTNYL 62 79********************************************97 PP
2	Myb_DNA-binding	54.7	2.3e-17	68	112	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T+eE++ ++++++ G++ W+ Ia+ ++ gRt++++k++w++ Traes_2DL_5A0300CE0.1 68 RGPFTPEEHKSILQLHAIVGNK-WSMIAAQLP-GRTDNEIKNYWNTN 112 89******************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.591	10	62	IPR017930	Myb domain
SuperFamily	SSF46689	4.03E-32	12	109	IPR009057	Homeodomain-like
SMART	SM00717	9.5E-13	14	64	IPR001005	SANT/Myb domain
Pfam	PF00249	2.9E-15	15	62	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.7E-24	16	69	IPR009057	Homeodomain-like
CDD	cd00167	7.47E-10	17	62	No hit	No description
PROSITE profile	PS51294	25.965	63	117	IPR017930	Myb domain
SMART	SM00717	5.2E-15	67	115	IPR001005	SANT/Myb domain
Pfam	PF00249	2.1E-15	68	113	IPR001005	SANT/Myb domain
CDD	cd00167	2.18E-11	70	113	No hit	No description
Gene3D	G3DSA:1.10.10.60	6.5E-27	70	117	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 142 aa Download sequence Send to blast
MGRTPCCESR QGLKKGPWTP EEDKLLVDYV QANAPGNWRM LPKLAGLNRC GKSCRLRWTN 60 YLRPDIKRGP FTPEEHKSIL QLHAIVGNKW SMIAAQLPGR TDNEIKNYWN TNLKKQLRQA 120 ALVGEKHHSA LASPGASAGA GC

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	4e-29	13	117	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may function in salt stress response. {ECO:0000305\|PubMed:26139822}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress. {ECO:0000269\|PubMed:26139822}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK108621	1e-138	AK108621.1 Oryza sativa Japonica Group cDNA clone:002-147-D04, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020156867.1	1e-104	myb-related protein Myb4-like
Swissprot	Q9M0Y5	2e-62	MYB74_ARATH; Transcription factor MYB74
TrEMBL	A0A1D5UP18	1e-102	A0A1D5UP18_WHEAT; Uncharacterized protein
TrEMBL	A0A453CFP2	1e-102	A0A453CFP2_AEGTS; Uncharacterized protein
STRING	Traes_2DL_5A0300CE0.1	1e-102	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP5409	31	57

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G05100.1	3e-64	myb domain protein 74

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Xu R, et al. Salt-induced transcription factor MYB74 is regulated by the RNA-directed DNA methylation pathway in Arabidopsis. J. Exp. Bot., 2015. 66(19): p. 5997-6008 [PMID:26139822] Huang KC,Lin WC,Cheng WH Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis. BMC Plant Biol., 2018. 18(1): p. 40 [PMID:29490615]