PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_2DL_1F0CDB1CE.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 131aa MW: 14340 Da PI: 10.7896 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 45.9 | 1.2e-14 | 57 | 113 | 6 | 62 |
HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 + r++kNRe+A rsR+RK+a+++eLe++v L + N +Lk + ++l+ e+a+l+++ Traes_2DL_1F0CDB1CE.1 57 KSVRAMKNRESALRSRARKRAYTQELEKEVRRLVEDNLKLKRQCKQLQSEIAALTAQ 113 568*************************************************99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 7.6E-12 | 51 | 116 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.806 | 54 | 110 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 6.25E-12 | 57 | 112 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 5.6E-14 | 58 | 113 | No hit | No description |
Pfam | PF00170 | 2.4E-11 | 59 | 112 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14707 | 9.66E-18 | 60 | 110 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 131 aa Download sequence Send to blast |
MSWEEPGSPQ LSLSGFSSLA SISSTAAPPA RLPSLSLSIG TGGEDQQLGV SSDDGHKSVR 60 AMKNRESALR SRARKRAYTQ ELEKEVRRLV EDNLKLKRQC KQLQSEIAAL TAQQASNKQS 120 SPHRRTSSTQ F |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK359958 | 1e-176 | AK359958.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1107F24. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020174160.1 | 5e-90 | bZIP transcription factor 27-like | ||||
TrEMBL | A0A3B6DK73 | 1e-88 | A0A3B6DK73_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A453D094 | 1e-88 | A0A453D094_AEGTS; Uncharacterized protein | ||||
STRING | Traes_2DL_1F0CDB1CE.1 | 2e-89 | (Triticum aestivum) | ||||
STRING | Traes_2DL_1F0CDB1CE1.1 | 2e-89 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4017 | 30 | 72 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G35900.1 | 1e-11 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|