PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_2BL_3E613DE21.2

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

M-type_MADS

Protein Properties

Length: 99aa MW: 11356.1 Da PI: 10.4525

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_2BL_3E613DE21.2	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	90.7	7.4e-29	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRrngi+KKA+EL +LCdaev ++ifsstg+lyey+s Traes_2BL_3E613DE21.2 10 RIDNSTSRQVTFSKRRNGIFKKAKELGILCDAEVGLVIFSSTGRLYEYAS 59 8***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	31.539	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.1E-38	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.17E-42	2	77	No hit	No description
SuperFamily	SSF55455	3.79E-33	2	84	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-28	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	5.8E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-28	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-28	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 99 aa Download sequence Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGIFK KAKELGILCD AEVGLVIFSS TGRLYEYASS 60 SMKSVIDRYG RAKEEQQLVA NPNSELKSYI QFFKYIYGF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-21	1	83	1	83	MEF2C
5f28_B	1e-21	1	83	1	83	MEF2C
5f28_C	1e-21	1	83	1	83	MEF2C
5f28_D	1e-21	1	83	1	83	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM502900	1e-139	AM502900.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM30 (WM30 gene).

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020189046.1	1e-56	MADS-box transcription factor 27-like isoform X1
Refseq	XP_020189047.1	1e-56	MADS-box transcription factor 27-like isoform X2
Swissprot	Q6EP49	1e-52	MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBL	A0A446MFF3	1e-56	A0A446MFF3_TRITD; Uncharacterized protein
STRING	Traes_2BL_3E613DE21.2	6e-66	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G37940.1	4e-46	AGAMOUS-like 21

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Puig J, et al. Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice. Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70 [PMID:23466806] Yu C, et al. The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice. PLoS ONE, 2014. 9(8): p. e105597 [PMID:25140876]