![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_2AS_759EDDA47.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 141aa MW: 16227.8 Da PI: 10.406 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 175.8 | 1.2e-54 | 12 | 141 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 lppGfrFhPtdee+v++yL++kv ++++++ +vi++vd++k ePw+Lp k+k +ekew+fF+++ +ky+tg+r+nratk+gyWkatgk Traes_2AS_759EDDA47.1 12 LPPGFRFHPTDEEVVTHYLTRKVLRESFSC-QVITDVDLNKNEPWELPGKAKMGEKEWFFFVHKGRKYPTGTRTNRATKKGYWKATGK 98 79****************************.99***************99999*********************************** PP NAM 89 dkevlsk...kgelvglkktLvfykgrapkgektdWvmheyrl 128 dke+++ + lvg+kktLvfy+grap+g kt Wvmheyrl Traes_2AS_759EDDA47.1 99 DKEIFRGkgrDAVLVGMKKTLVFYTGRAPSGGKTPWVMHEYRL 141 *****984444445***************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.71E-57 | 7 | 141 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 53.823 | 12 | 141 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.3E-29 | 13 | 141 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
MSDVTAVMDL ALPPGFRFHP TDEEVVTHYL TRKVLRESFS CQVITDVDLN KNEPWELPGK 60 AKMGEKEWFF FVHKGRKYPT GTRTNRATKK GYWKATGKDK EIFRGKGRDA VLVGMKKTLV 120 FYTGRAPSGG KTPWVMHEYR L |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 3e-50 | 1 | 141 | 9 | 145 | NAC domain-containing protein 19 |
3swm_B | 3e-50 | 1 | 141 | 9 | 145 | NAC domain-containing protein 19 |
3swm_C | 3e-50 | 1 | 141 | 9 | 145 | NAC domain-containing protein 19 |
3swm_D | 3e-50 | 1 | 141 | 9 | 145 | NAC domain-containing protein 19 |
3swp_A | 3e-50 | 1 | 141 | 9 | 145 | NAC domain-containing protein 19 |
3swp_B | 3e-50 | 1 | 141 | 9 | 145 | NAC domain-containing protein 19 |
3swp_C | 3e-50 | 1 | 141 | 9 | 145 | NAC domain-containing protein 19 |
3swp_D | 3e-50 | 1 | 141 | 9 | 145 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ010830 | 0.0 | AJ010830.1 Triticum sp. mRNA for GRAB2 protein. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020166615.1 | 1e-94 | NAC domain-containing protein 92-like isoform X1 | ||||
Refseq | XP_020166616.1 | 1e-94 | NAC domain-containing protein 92-like isoform X2 | ||||
Swissprot | Q9FLJ2 | 1e-65 | NC100_ARATH; NAC domain-containing protein 100 | ||||
TrEMBL | A0A3B6AS67 | 1e-100 | A0A3B6AS67_WHEAT; Uncharacterized protein | ||||
STRING | Traes_2AS_759EDDA47.1 | 1e-101 | (Triticum aestivum) | ||||
STRING | TRIUR3_24111-P1 | 1e-101 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1862 | 38 | 104 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G61430.1 | 4e-68 | NAC domain containing protein 100 |
Publications ? help Back to Top | |||
---|---|---|---|
|