![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_2AS_5D0C0E5BB.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | BES1 | ||||||||
Protein Properties | Length: 90aa MW: 10086.4 Da PI: 10.7229 | ||||||||
Description | BES1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF822 | 155.7 | 3.3e-48 | 17 | 88 | 2 | 73 |
DUF822 2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgs 73 g gr+ptwkErEnnkrRERrRRaiaaki++GLRa Gnyklpk++DnneVlk LcreAGwvvedDGttyrk s Traes_2AS_5D0C0E5BB.1 17 GLGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYKLPKHCDNNEVLKELCREAGWVVEDDGTTYRKVS 88 679******************************************************************965 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05687 | 6.5E-44 | 18 | 88 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 90 aa Download sequence Send to blast |
MTSGAARAAA AAEAEAGLGR TPTWKERENN KRRERRRRAI AAKIFTGLRA LGNYKLPKHC 60 DNNEVLKELC REAGWVVEDD GTTYRKVSAR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zd4_A | 4e-24 | 20 | 86 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_B | 4e-24 | 20 | 86 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_C | 4e-24 | 20 | 86 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_D | 4e-24 | 20 | 86 | 372 | 438 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Positive brassinosteroid-signaling protein. Mediates downstream brassinosteroid-regulated growth response and feedback inhibition of brassinosteroid biosynthetic genes. May act as transcriptional repressor by binding the brassinosteroid-response element (5'-CGTGCG-3') in the promoter of GRAS32 (AC Q9LWU9), another positive regulator of brassinosteroid signaling (By similarity). {ECO:0000250}. | |||||
UniProt | Positive brassinosteroid-signaling protein. Mediates downstream brassinosteroid-regulated growth response and feedback inhibition of brassinosteroid (BR) biosynthetic genes (PubMed:17699623, PubMed:19220793). May act as transcriptional repressor by binding the brassinosteroid-response element (BREE) (5'-CGTG(T/C)G-3') in the promoter of DLT (AC Q9LWU9), another positive regulator of BR signaling (PubMed:19220793). Acts as transcriptional repressor of LIC, a negative regulator of BR signaling, by binding to the BRRE element of its promoter. BZR1 and LIC play opposite roles in BR signaling and regulation of leaf bending (PubMed:22570626). {ECO:0000269|PubMed:17699623, ECO:0000269|PubMed:19220793, ECO:0000269|PubMed:22570626}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by 24-epibrassinolide. {ECO:0000269|PubMed:22570626}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JN400739 | 1e-143 | JN400739.1 Triticum aestivum cultivar Chinese Spring BES1 mRNA, complete cds. | |||
GenBank | JN400740 | 1e-143 | JN400740.1 Triticum aestivum cultivar Chinese Spring BES1S mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020151437.1 | 2e-55 | protein BZR1 homolog 1 | ||||
Swissprot | B8B7S5 | 6e-28 | BZR1_ORYSI; Protein BZR1 homolog 1 | ||||
Swissprot | Q7XI96 | 6e-28 | BZR1_ORYSJ; Protein BZR1 homolog 1 | ||||
TrEMBL | A0A446KT22 | 8e-58 | A0A446KT22_TRITD; Uncharacterized protein | ||||
STRING | Traes_2AS_5D0C0E5BB.1 | 1e-58 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP5474 | 34 | 53 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G36780.1 | 9e-25 | BES1/BZR1 homolog 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|