![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_2AS_239CDF865.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 105aa MW: 11024.7 Da PI: 10.1705 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 36.6 | 1.1e-11 | 71 | 102 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g+WT+eEd+ lv +v+++G+g+W++++ + g Traes_2AS_239CDF865.1 71 KGPWTPEEDLVLVSYVQEHGPGNWRAVPTRTG 102 79************************998766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-13 | 62 | 100 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.15E-9 | 65 | 101 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 17.099 | 66 | 105 | IPR017930 | Myb domain |
Pfam | PF00249 | 2.8E-10 | 71 | 103 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.31E-8 | 73 | 102 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 105 aa Download sequence Send to blast |
RSSGPRHAIL LVYGAGGRPL VPAHLATAAK GDRPLRPFLP LIPFGVAEVA SGGAGKSMGR 60 PPCCDKEGVK KGPWTPEEDL VLVSYVQEHG PGNWRAVPTR TGTHP |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT009312 | 1e-70 | BT009312.1 Triticum aestivum clone wlm1.pk0027.a5:fis, full insert mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
TrEMBL | A0A287HHW5 | 4e-34 | A0A287HHW5_HORVV; Uncharacterized protein | ||||
STRING | Traes_2AS_239CDF865.1 | 5e-70 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP229 | 38 | 296 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G47600.1 | 2e-27 | myb domain protein 94 |
Publications ? help Back to Top | |||
---|---|---|---|
|