PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_2AL_D3B2C21A7.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 88aa MW: 9899.11 Da PI: 9.0995 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 82.8 | 5e-26 | 13 | 71 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+y +++d+e++++isw+e+g++fvv+ + ef++++Lpk FkhsnfaSFvRQLn+Y Traes_2AL_D3B2C21A7.1 13 FLTKTYAMVDDPETDDTISWNESGTAFVVWRRAEFERDLLPKNFKHSNFASFVRQLNTY 71 9********************************************************** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 2.4E-27 | 8 | 72 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 4.0E-21 | 9 | 87 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 4.62E-23 | 11 | 71 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
PRINTS | PR00056 | 5.6E-15 | 13 | 36 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 1.0E-21 | 13 | 71 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 5.6E-15 | 51 | 63 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 5.6E-15 | 64 | 76 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
MASPALGAGT PPFLTKTYAM VDDPETDDTI SWNESGTAFV VWRRAEFERD LLPKNFKHSN 60 FASFVRQLNT YVRSVSARPP LSGWFGRS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1hks_A | 1e-19 | 7 | 71 | 1 | 65 | HEAT-SHOCK TRANSCRIPTION FACTOR |
1hkt_A | 1e-19 | 7 | 71 | 1 | 65 | HEAT-SHOCK TRANSCRIPTION FACTOR |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU953624 | 1e-116 | EU953624.1 Zea mays clone 1440437 heat shock factor protein 4 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020152813.1 | 1e-45 | heat stress transcription factor B-2a-like | ||||
Swissprot | Q7XRX3 | 2e-36 | HFB2A_ORYSJ; Heat stress transcription factor B-2a | ||||
TrEMBL | A0A446LBY4 | 2e-57 | A0A446LBY4_TRITD; Uncharacterized protein | ||||
STRING | Traes_2AL_D3B2C21A7.1 | 4e-59 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP121 | 37 | 394 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G36990.1 | 4e-29 | heat shock factor 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|