PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

MYB_related

Protein Properties

Length: 112aa MW: 12824.8 Da PI: 9.765

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_2AL_839C94CA3.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.8	1e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+ +++q G g+W++ +++ g+ R++k+c++rw +yl Traes_2AL_839C94CA3.1 14 KGPWTPEEDQKLLSYIEQQGHGCWRSLPAKAGLQRCGKSCRLRWTNYL 61 79********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.5E-26	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	23.216	9	65	IPR017930	Myb domain
SMART	SM00717	6.4E-13	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	3.7E-16	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	2.15E-23	15	90	IPR009057	Homeodomain-like
CDD	cd00167	2.90E-11	16	61	No hit	No description
PROSITE profile	PS50090	3.903	62	99	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	1.8E-9	65	98	IPR009057	Homeodomain-like
SMART	SM00717	22	66	103	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 112 aa Download sequence Send to blast
MGRSPCCEKE GLKKGPWTPE EDQKLLSYIE QQGHGCWRSL PAKAGLQRCG KSCRLRWTNY 60 LRPDIKRGKF SLQEEQTIIQ LHALLGNRSS PIPAHHGRTV LHMPLNLHPE FT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	7e-17	12	92	5	84	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269\|PubMed:18805951, ECO:0000269\|PubMed:21070410, ECO:0000269\|PubMed:23709630, ECO:0000269\|PubMed:24169067}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK360378	1e-141	AK360378.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1116O14.
GenBank	JF951918	1e-141	JF951918.1 Triticum aestivum clone TaMYB16 R2R3-MYB protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020168407.1	1e-60	myb-related protein Myb4-like
Swissprot	Q9LE63	6e-56	MY106_ARATH; Transcription factor MYB106
TrEMBL	A0A446L6E9	2e-77	A0A446L6E9_TRITD; Uncharacterized protein
STRING	Traes_2AL_839C94CA3.1	3e-78	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP116	37	448

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G15310.2	2e-57	myb domain protein 16

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148]