 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Traes_1DL_772D1D7DF.1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
Family |
Trihelix |
Protein Properties |
Length: 78aa MW: 9274.65 Da PI: 10.4281 |
Description |
Trihelix family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Traes_1DL_772D1D7DF.1 | genome | IWGSC | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | trihelix | 88.9 | 5.6e-28 | 2 | 68 | 20 | 87 |
trihelix 20 rlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87
r++++ k+plWee+s+ mr+ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+qlea
Traes_1DL_772D1D7DF.1 2 RYQEAGPKGPLWEEISAGMRRMGYNRSSKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLEA 68
6788999********************************************8.99***********85 PP
|
Protein Features
? help Back to Top |
 |
Database |
Entry ID |
E-value |
Start |
End |
InterPro ID |
Description |
CDD | cd12203 | 7.99E-18 | 2 | 47 | No hit | No description |
Pfam | PF13837 | 4.4E-19 | 3 | 69 | No hit | No description |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor that binds specific DNA sequence. {ECO:0000250}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AK354426 | 1e-118 | AK354426.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1007E05. |
GenBank | AK361507 | 1e-118 | AK361507.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1142F04. |
GenBank | AK372713 | 1e-118 | AK372713.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3010E21. |