PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_1DL_0D056C042.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 70aa MW: 7348.54 Da PI: 9.5252 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 42.7 | 2e-13 | 27 | 59 | 22 | 54 |
YABBY 22 lavsvPstslfkvvtvrCGhCtsllsvnlakas 54 + vsvPs+slfk+vtvrCGhC+sll+v+++ Traes_1DL_0D056C042.1 27 VQVSVPSSSLFKTVTVRCGHCSSLLTVDMRGLL 59 67*************************998765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 1.6E-12 | 27 | 62 | IPR006780 | YABBY protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 70 aa Download sequence Send to blast |
ASKRLSVCSS AAAAPPFKSI YREVTGVQVS VPSSSLFKTV TVRCGHCSSL LTVDMRGLLF 60 PTTTTTVVAE |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY330228 | 7e-59 | AY330228.1 Triticum aestivum YABBY protein (YAB1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001105231.1 | 4e-15 | yabby 9 | ||||
TrEMBL | A0A3L6ER46 | 2e-15 | A0A3L6ER46_MAIZE; Protein YABBY 3 | ||||
STRING | Traes_1DL_0D056C042.1 | 3e-42 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP51640 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G00180.2 | 9e-14 | YABBY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|