PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AS_59001495A.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family YABBY
Protein Properties Length: 47aa    MW: 5557.25 Da    PI: 9.2593
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AS_59001495A.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY838.6e-26242130170
                  YABBY 130 nrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                            n +i+eei+rika+nPdishreafs+aaknWah+P+ihfgl
  Traes_1AS_59001495A.1   2 NLMIREEIRRIKANNPDISHREAFSTAAKNWAHYPNIHFGL 42 
                            789************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046908.0E-24242IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 47 aa     Download sequence    Send to blast
INLMIREEIR RIKANNPDIS HREAFSTAAK NWAHYPNIHF GLNPERD
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0091063e-63BT009106.1 Triticum aestivum clone wkm2n.pk008.p10:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020152569.12e-24protein YABBY 6-like, partial
SwissprotQ2QM173e-22YAB6_ORYSJ; Protein YABBY 6
TrEMBLA0A453JK095e-23A0A453JK09_AEGTS; Uncharacterized protein
STRINGTraes_1AS_59001495A.14e-27(Triticum aestivum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.25e-22YABBY family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]