PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_1AS_59001495A.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 47aa MW: 5557.25 Da PI: 9.2593 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 83 | 8.6e-26 | 2 | 42 | 130 | 170 |
YABBY 130 nrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 n +i+eei+rika+nPdishreafs+aaknWah+P+ihfgl Traes_1AS_59001495A.1 2 NLMIREEIRRIKANNPDISHREAFSTAAKNWAHYPNIHFGL 42 789************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 8.0E-24 | 2 | 42 | IPR006780 | YABBY protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 47 aa Download sequence Send to blast |
INLMIREEIR RIKANNPDIS HREAFSTAAK NWAHYPNIHF GLNPERD |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT009106 | 3e-63 | BT009106.1 Triticum aestivum clone wkm2n.pk008.p10:fis, full insert mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020152569.1 | 2e-24 | protein YABBY 6-like, partial | ||||
Swissprot | Q2QM17 | 3e-22 | YAB6_ORYSJ; Protein YABBY 6 | ||||
TrEMBL | A0A453JK09 | 5e-23 | A0A453JK09_AEGTS; Uncharacterized protein | ||||
STRING | Traes_1AS_59001495A.1 | 4e-27 | (Triticum aestivum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G26580.2 | 5e-22 | YABBY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|