PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

M-type_MADS

Protein Properties

Length: 75aa MW: 8375.69 Da PI: 10.2346

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_1AS_24511D656.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	87.7	6.3e-28	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ++ien++ rqvtfskR+ g++KKA EL vLCda+vav++fs+tg+ly+yss Traes_1AS_24511D656.1 9 EKIENTTSRQVTFSKRKSGLFKKARELGVLCDAQVAVLLFSNTGRLYDYSS 59 58***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	28.903	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.6E-34	1	60	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.8E-26	3	23	IPR002100	Transcription factor, MADS-box
CDD	cd00265	7.34E-33	3	60	No hit	No description
SuperFamily	SSF55455	2.09E-26	3	61	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	5.0E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.8E-26	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.8E-26	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 75 aa Download sequence Send to blast
MVRGKTVIEK IENTTSRQVT FSKRKSGLFK KARELGVLCD AQVAVLLFSN TGRLYDYSSS 60 NSGYVNFDPL LLTIV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	5e-15	1	65	1	65	MEF2C
5f28_B	5e-15	1	65	1	65	MEF2C
5f28_C	5e-15	1	65	1	65	MEF2C
5f28_D	5e-15	1	65	1	65	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	MADS-box transcription factor that acts with AGL42 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269\|PubMed:21609362}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK371442	2e-65	AK371442.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2134C13.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020165070.1	5e-34	MADS-box transcription factor 23-like
Swissprot	Q9LT93	1e-26	AGL71_ARATH; MADS-box protein AGL71
TrEMBL	A0A3B5XUD9	1e-36	A0A3B5XUD9_WHEAT; Uncharacterized protein
TrEMBL	A0A446IJN4	2e-37	A0A446IJN4_TRITD; Uncharacterized protein
STRING	Traes_1AS_24511D656.1	8e-48	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G51870.2	2e-29	AGAMOUS-like 71

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148]