PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AL_6F5982F88.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family M-type_MADS
Protein Properties Length: 79aa    MW: 9082.63 Da    PI: 10.1862
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AL_6F5982F88.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.73.6e-29959151
                           S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                 SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                           krien++ rqvtfskRrng+lKKA+ELSvLCd+eva+ +f ++g+lye+ss
  Traes_1AL_6F5982F88.1  9 KRIENETSRQVTFSKRRNGLLKKAFELSVLCDVEVALAVFCPRGRLYEFSS 59
                           79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.053161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-27361IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-29323IPR002100Transcription factor, MADS-box
CDDcd002651.19E-35359No hitNo description
PfamPF003195.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 79 aa     Download sequence    Send to blast
MVRGKTEMKR IENETSRQVT FSKRRNGLLK KAFELSVLCD VEVALAVFCP RGRLYEFSSA  60
TSCCPFYPNV SVRTRCTRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A4e-16359258Myocyte-specific enhancer factor 2A
3mu6_B4e-16359258Myocyte-specific enhancer factor 2A
3mu6_C4e-16359258Myocyte-specific enhancer factor 2A
3mu6_D4e-16359258Myocyte-specific enhancer factor 2A
5f28_A6e-16159159MEF2C
5f28_B6e-16159159MEF2C
5f28_C6e-16159159MEF2C
5f28_D6e-16159159MEF2C
6byy_A5e-16160160MEF2 CHIMERA
6byy_B5e-16160160MEF2 CHIMERA
6byy_C5e-16160160MEF2 CHIMERA
6byy_D5e-16160160MEF2 CHIMERA
6bz1_A5e-16160160MEF2 CHIMERA
6bz1_B5e-16160160MEF2 CHIMERA
6bz1_C5e-16160160MEF2 CHIMERA
6bz1_D5e-16160160MEF2 CHIMERA
6c9l_C6e-16159159Myocyte-specific enhancer factor 2B
6c9l_D6e-16159159Myocyte-specific enhancer factor 2B
6c9l_E6e-16159159Myocyte-specific enhancer factor 2B
6c9l_F6e-16159159Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269|PubMed:24121311}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. {ECO:0000269|PubMed:24121311}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM5028622e-78AM502862.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM1B (WM1B gene).
GenBankDQ5123632e-78DQ512363.1 Triticum aestivum MADS-box transcription factor TaAGL7 (AGL7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020179424.12e-35agamous-like MADS-box protein AGL14
SwissprotQ388389e-33AGL14_ARATH; Agamous-like MADS-box protein AGL14
TrEMBLA0A446IYD04e-36A0A446IYD0_TRITD; Uncharacterized protein
STRINGTraes_1AL_6F5982F88.16e-51(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.14e-35AGAMOUS-like 14
Publications ? help Back to Top
  1. Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W
    GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox.
    Plant Physiol., 2004. 136(1): p. 2621-32
    [PMID:15375207]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  4. Qu Y, et al.
    Peroxisomal CuAOζ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis.
    J. Exp. Bot., 2017. 68(17): p. 4851-4867
    [PMID:28992128]