PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella

Family

MYB_related

Protein Properties

Length: 146aa MW: 16295.4 Da PI: 10.6354

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Tp7g08810	genome	thellungiella	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	47.6	3.8e-15	106	146	1	43
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 +++WTteE+ l +a +++G++ W+ Ia+ ++ gRt++ +k++ Tp7g08810 106 KDAWTTEEESALMNAQRMHGNK-WTEIAKVLN-GRTDNAIKNH 146 689*****************.*****.*******9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	6.13E-18	89	146	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	3.2E-5	89	113	IPR009057	Homeodomain-like
PROSITE profile	PS51294	22.037	101	146	IPR017930	Myb domain
SMART	SM00717	2.5E-5	105	146	IPR001005	SANT/Myb domain
Pfam	PF00249	6.0E-13	106	146	IPR001005	SANT/Myb domain
CDD	cd00167	4.20E-10	108	146	No hit	No description
Gene3D	G3DSA:1.10.10.60	5.0E-14	114	146	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 146 aa Download sequence Send to blast
MRSNSNPATG SPEKEERSEL KVEIHCMENK QPTPASCSSA SEGSGNFFLK SPEIATPAAT 60 SSPTPRRTSG PMRRAKGGKK VWTCQMVCNR KVFTRWHNRL NPGIRKDAWT TEEESALMNA 120 QRMHGNKWTE IAKVLNGRTD NAIKNH

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-16	95	146	48	99	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (By similarity). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). {ECO:0000250\|UniProtKB:Q94FL9, ECO:0000269\|PubMed:26069325}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Tp7g08810

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Slightly induced by ethylene and salicylic acid (SA). {ECO:0000269\|PubMed:16463103}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006287439.1	6e-48	transcription factor MYB3R-5
Swissprot	Q6R032	7e-49	MB3R5_ARATH; Transcription factor MYB3R-5
TrEMBL	R0FDT2	1e-46	R0FDT2_9BRAS; Uncharacterized protein
STRING	Bostr.6251s0040.1.p	2e-48	(Boechera stricta)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G02320.2	3e-51	myb domain protein 3r-5

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kobayashi K, et al. Transcriptional repression by MYB3R proteins regulates plant organ growth. EMBO J., 2015. 34(15): p. 1992-2007 [PMID:26069325] Chen P, et al. Arabidopsis R1R2R3-Myb proteins are essential for inhibiting cell division in response to DNA damage. Nat Commun, 2017. 8(1): p. 635 [PMID:28935922]