PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella

Family

MYB_related

Protein Properties

Length: 102aa MW: 11119.6 Da PI: 10.7681

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Tp6g16960	genome	thellungiella	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53.1	7.3e-17	30	77	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+ Ede+l+ +v++ G g+W+++ + g+ R++k+c++rw ++l Tp6g16960 30 KGPWTAAEDEILAAYVRENGEGNWNAVQKNTGLARCGKSCRLRWANHL 77 79******************************************9996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	21.069	25	81	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	3.0E-21	28	85	IPR009057	Homeodomain-like
SMART	SM00717	1.6E-12	29	79	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-15	30	77	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	8.58E-17	31	87	IPR009057	Homeodomain-like
CDD	cd00167	1.28E-9	32	77	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 102 aa Download sequence Send to blast
MILYGGGAGK DGGSTNHISD GGGGGVVLKK GPWTAAEDEI LAAYVRENGE GNWNAVQKNT 60 GLARCGKSCR LRWANHLRPN LKKRLFHRRR RTSHYPASCS AW

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	81	90	KKRLFHRRRR

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator (PubMed:24278028). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter to promote their expression (By similarity). Together with MYB97 and MYB101, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000250\|UniProtKB:O80883, ECO:0000269\|PubMed:23791732, ECO:0000269\|PubMed:24278028}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Tp6g16960

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Accumulates in pollen tube 4 hours after pollen germination. {ECO:0000269\|PubMed:19714218}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC189303	1e-115	AC189303.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB030F12, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018475832.1	8e-45	PREDICTED: transcription factor MYB86
Swissprot	Q94FL7	6e-40	MY120_ARATH; Transcription factor MYB120
TrEMBL	A0A078J922	9e-44	A0A078J922_BRANA; BnaC03g71630D protein
STRING	Bra028997.1-P	1e-43	(Brassica rapa)
STRING	A0A087GB55	9e-44	(Arabis alpina)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G55020.1	2e-34	myb domain protein 120

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]