![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp6g14110 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 217aa MW: 25072 Da PI: 9.8863 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 86.8 | 1.2e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien++ rqvtfskRr g++KKA+ELSvLCda+va +ifs++g+ly+++s Tp6g14110 9 KKIENTTSRQVTFSKRRSGLFKKAHELSVLCDAQVAAMIFSQKGRLYDFAS 59 68***********************************************86 PP | |||||||
2 | K-box | 55.1 | 3.2e-19 | 102 | 171 | 24 | 93 |
K-box 24 LkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 + ++ie+L+ +R+l+G++L +s+keLq + q+eksl +Rs+K +l+ +++e+l+ ke+el+++ + Tp6g14110 102 MVEKIEMLEVHNRKLMGQNLAFCSVKELQDIALQIEKSLHIVRSRKAKLYEDEVEKLKAKERELKDDRVR 171 6689*****999****************************************************998765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 6.4E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.371 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.3E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.99E-40 | 3 | 76 | No hit | No description |
SuperFamily | SSF55455 | 4.71E-31 | 3 | 87 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.6E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.3E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.3E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 10.441 | 92 | 193 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 4.8E-18 | 102 | 173 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 217 aa Download sequence Send to blast |
MVRGKIEIKK IENTTSRQVT FSKRRSGLFK KAHELSVLCD AQVAAMIFSQ KGRLYDFASS 60 DIQKTIKRYA EYKREHFVAE SHPIEQYVQL GYTGTKEGNG TMVEKIEMLE VHNRKLMGQN 120 LAFCSVKELQ DIALQIEKSL HIVRSRKAKL YEDEVEKLKA KERELKDDRV RLCGRKIIYI 180 YSYILQVGER SMGMTSGSKE KEDVETNLFI GLPKSQP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 6e-20 | 1 | 76 | 1 | 76 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 6e-20 | 1 | 76 | 1 | 76 | Myocyte-specific enhancer factor 2B |
1tqe_R | 6e-20 | 1 | 76 | 1 | 76 | Myocyte-specific enhancer factor 2B |
1tqe_S | 6e-20 | 1 | 76 | 1 | 76 | Myocyte-specific enhancer factor 2B |
5f28_A | 5e-20 | 1 | 76 | 1 | 76 | MEF2C |
5f28_B | 5e-20 | 1 | 76 | 1 | 76 | MEF2C |
5f28_C | 5e-20 | 1 | 76 | 1 | 76 | MEF2C |
5f28_D | 5e-20 | 1 | 76 | 1 | 76 | MEF2C |
6c9l_A | 6e-20 | 1 | 76 | 1 | 76 | Myocyte-specific enhancer factor 2B |
6c9l_B | 6e-20 | 1 | 76 | 1 | 76 | Myocyte-specific enhancer factor 2B |
6c9l_C | 6e-20 | 1 | 76 | 1 | 76 | Myocyte-specific enhancer factor 2B |
6c9l_D | 6e-20 | 1 | 76 | 1 | 76 | Myocyte-specific enhancer factor 2B |
6c9l_E | 6e-20 | 1 | 76 | 1 | 76 | Myocyte-specific enhancer factor 2B |
6c9l_F | 6e-20 | 1 | 76 | 1 | 76 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp6g14110 |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010443997.1 | 1e-120 | PREDICTED: MADS-box protein AGL72 | ||||
Refseq | XP_019087581.1 | 1e-120 | PREDICTED: MADS-box protein AGL72 | ||||
Swissprot | Q9FLH5 | 1e-117 | AGL72_ARATH; MADS-box protein AGL72 | ||||
TrEMBL | M4EHL7 | 1e-117 | M4EHL7_BRARP; Uncharacterized protein | ||||
STRING | XP_010443990.1 | 1e-119 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51860.1 | 1e-119 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|