PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella

Family

MYB_related

Protein Properties

Length: 233aa MW: 26393.6 Da PI: 5.0306

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Tp5g29600	genome	thellungiella	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53.2	6.7e-17	26	70	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T++E+e +++ + +lG++ W++Ia+ m +Rt++++k++w++ Tp5g29600 26 RGKFTPQEEEDIIKFHSLLGNR-WAAIAKQML-NRTDNDIKNHWNSC 70 89******************.****9.*********975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50090	4.391	1	20	IPR017877	Myb-like domain
SuperFamily	SSF46689	1.57E-20	6	76	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.8E-11	6	31	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.265	21	75	IPR017930	Myb domain
SMART	SM00717	7.1E-15	25	73	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-15	26	70	IPR001005	SANT/Myb domain
CDD	cd00167	2.55E-10	28	68	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.0E-20	32	75	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 233 aa Download sequence Send to blast
MQKGLQRCGK SCRLRWLNYL RPGIKRGKFT PQEEEDIIKF HSLLGNRWAA IAKQMLNRTD 60 NDIKNHWNSC LKKRLFRSGI DPMTHEPIVP VVTSSSTTSS PTPTPSSSSS SSSFSSTGSA 120 RLLNKLAAEI SSRKHGLDRI KTVILSEPRQ AIEEEKITTI SKEEEEEEDE DVIACFMEID 180 ENLISTTSFD ELPCDSTTTI GFTAAFDDYS SIQPYDLYKS DFYQNTYDDP FLL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-19	7	75	40	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in tryptophan gene activation and in indole-3-acetic acid (IAA) and indolic glucosinolates (IG) biosynthesis. Acts as a direct transcriptional activator of both Trp synthesis genes and Trp secondary metabolism genes. {ECO:0000269\|PubMed:15579661, ECO:0000269\|PubMed:23580754, ECO:0000269\|PubMed:23943862, ECO:0000269\|PubMed:9576939}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Tp5g29600

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by herbivory. {ECO:0000269\|PubMed:23943862}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF738285	1e-137	KF738285.1 Brassica napus MYB transcription factor 95 (MYB95.1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006390428.1	1e-119	transcription factor MYB106
Swissprot	O64399	6e-41	MYB34_ARATH; Transcription factor MYB34
TrEMBL	V4K9J5	1e-117	V4K9J5_EUTSA; Uncharacterized protein
STRING	XP_006390428.1	1e-118	(Eutrema salsugineum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G74430.1	2e-84	myb domain protein 95

Publications ? help Back to Top
Grubb CD,Abel S Glucosinolate metabolism and its control. Trends Plant Sci., 2006. 11(2): p. 89-100 [PMID:16406306] De Schutter K, et al. Arabidopsis WEE1 kinase controls cell cycle arrest in response to activation of the DNA integrity checkpoint. Plant Cell, 2007. 19(1): p. 211-25 [PMID:17209125] Kim K,Jiang K,Teng SL,Feldman LJ,Huang H Using biologically interrelated experiments to identify pathway genes in Arabidopsis. Bioinformatics, 2012. 28(6): p. 815-22 [PMID:22271267] Guo R, et al. Jasmonic acid and glucose synergistically modulate the accumulation of glucosinolates in Arabidopsis thaliana. J. Exp. Bot., 2013. 64(18): p. 5707-19 [PMID:24151308] Benstein RM, et al. Arabidopsis phosphoglycerate dehydrogenase1 of the phosphoserine pathway is essential for development and required for ammonium assimilation and tryptophan biosynthesis. Plant Cell, 2013. 25(12): p. 5011-29 [PMID:24368794] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Frerigmann H,Gigolashvili T MYB34, MYB51, and MYB122 distinctly regulate indolic glucosinolate biosynthesis in Arabidopsis thaliana. Mol Plant, 2014. 7(5): p. 814-28 [PMID:24431192] Frerigmann H,Gigolashvili T Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency. Front Plant Sci, 2014. 5: p. 626 [PMID:25426131] Frerigmann H,Glawischnig E,Gigolashvili T The role of MYB34, MYB51 and MYB122 in the regulation of camalexin biosynthesis in Arabidopsis thaliana. Front Plant Sci, 2015. 6: p. 654 [PMID:26379682] Frerigmann H, et al. Regulation of Pathogen-Triggered Tryptophan Metabolism in Arabidopsis thaliana by MYB Transcription Factors and Indole Glucosinolate Conversion Products. Mol Plant, 2016. 9(5): p. 682-695 [PMID:26802248] Stahl E, et al. Regulatory and Functional Aspects of Indolic Metabolism in Plant Systemic Acquired Resistance. Mol Plant, 2016. 9(5): p. 662-681 [PMID:26802249] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Miao H, et al. Glucose enhances indolic glucosinolate biosynthesis without reducing primary sulfur assimilation. Sci Rep, 2016. 6: p. 31854 [PMID:27549907]