PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium

Family

HSF

Protein Properties

Length: 110aa MW: 12628 Da PI: 4.6366

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Tp57577_TGAC_v2_mRNA7357	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	84.3	1.8e-26	52	110	2	60
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+y+++ed+++++++sw+++g sfvv+d++ f++++Lp+yFkh+nf+SFvRQLn+Y Tp57577_TGAC_v2_mRNA7357 52 FLTKTYDVVEDPTTSHIVSWNRDGASFVVWDPNAFSRDLLPRYFKHNNFSSFVRQLNTY 110 9*********************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	1.4E-28	45	110	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	3.4E-21	48	110	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	2.99E-24	50	110	IPR011991	Winged helix-turn-helix DNA-binding domain
Pfam	PF00447	1.2E-22	52	110	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	5.7E-17	52	75	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	5.7E-17	90	102	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	5.7E-17	103	110	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 110 aa Download sequence Send to blast
MNYLYPVKEE YLEIEATSSS ASTTYERGSD EGSMVVIPRP MEGLHEVGPP PFLTKTYDVV 60 EDPTTSHIVS WNRDGASFVV WDPNAFSRDL LPRYFKHNNF SSFVRQLNTY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d8k_B	3e-18	50	110	3	63	Heat shock factor protein 2
5d8l_B	3e-18	50	110	3	63	Heat shock factor protein 2
5d8l_D	3e-18	50	110	3	63	Heat shock factor protein 2
5d8l_F	3e-18	50	110	3	63	Heat shock factor protein 2
5d8l_H	3e-18	50	110	3	63	Heat shock factor protein 2
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269\|PubMed:16202242}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Tp57577_TGAC_v2_mRNA7357

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat stress. {ECO:0000269\|PubMed:16202242}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ455122	3e-65	DQ455122.1 Medicago truncatula cDNA-AFLP fragment BC21M13_50 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024625396.1	2e-68	heat stress transcription factor A-6b isoform X1
Refseq	XP_024625397.1	2e-68	heat stress transcription factor A-6b isoform X2
Swissprot	Q338B0	3e-39	HFA2C_ORYSJ; Heat stress transcription factor A-2c
TrEMBL	A0A2K3LXY8	4e-76	A0A2K3LXY8_TRIPR; Heat stress transcription factor a-6b-like protein
STRING	XP_004493725.1	8e-60	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1592	33	95

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G22830.1	3e-38	heat shock transcription factor A6B

Link Out ? help Back to Top
Phytozome	Tp57577_TGAC_v2_mRNA7357

Publications ? help Back to Top
Rice Chromosome 10 Sequencing Consortium In-depth view of structure, activity, and evolution of rice chromosome 10. Science, 2003. 300(5625): p. 1566-9 [PMID:12791992] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Singh A, et al. OsHsfA2c and OsHsfB4b are involved in the transcriptional regulation of cytoplasmic OsClpB (Hsp100) gene in rice (Oryza sativa L.). Cell Stress Chaperones, 2012. 17(2): p. 243-54 [PMID:22147560]