![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp57577_TGAC_v2_mRNA35519 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
Family | CAMTA | ||||||||
Protein Properties | Length: 91aa MW: 10967.1 Da PI: 11.3087 | ||||||||
Description | CAMTA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CG-1 | 69 | 7.4e-22 | 47 | 87 | 36 | 76 |
CG-1 36 sgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvg 76 gsl+L++rk++ryfrkDG++w+k+kdgktvrE+he+LK+ Tp57577_TGAC_v2_mRNA35519 47 GGSLLLFDRKVTRYFRKDGHNWRKQKDGKTVREAHERLKIR 87 59*************************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51437 | 29.383 | 1 | 90 | IPR005559 | CG-1 DNA-binding domain |
SMART | SM01076 | 7.4E-5 | 27 | 90 | IPR005559 | CG-1 DNA-binding domain |
Pfam | PF03859 | 2.2E-16 | 47 | 87 | IPR005559 | CG-1 DNA-binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 91 aa Download sequence Send to blast |
LYQKHNIDGY VQLKFAKFSL IRPTFRLLLN LHICLQFLIM VFWITLGGSL LLFDRKVTRY 60 FRKDGHNWRK QKDGKTVREA HERLKIRIHK * |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp57577_TGAC_v2_mRNA35519 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012437208.1 | 2e-20 | PREDICTED: calmodulin-binding transcription activator 3 isoform X2 | ||||
Refseq | XP_012437209.1 | 2e-20 | PREDICTED: calmodulin-binding transcription activator 3 isoform X2 | ||||
Refseq | XP_012437210.1 | 2e-20 | PREDICTED: calmodulin-binding transcription activator 3 isoform X2 | ||||
Refseq | XP_012437211.1 | 2e-20 | PREDICTED: calmodulin-binding transcription activator 3 isoform X2 | ||||
Refseq | XP_016738097.1 | 2e-20 | PREDICTED: calmodulin-binding transcription activator 3-like isoform X2 | ||||
Refseq | XP_016738099.1 | 2e-20 | PREDICTED: calmodulin-binding transcription activator 3-like isoform X2 | ||||
Refseq | XP_016738100.1 | 2e-20 | PREDICTED: calmodulin-binding transcription activator 3-like isoform X2 | ||||
TrEMBL | A0A2G5E9C5 | 2e-25 | A0A2G5E9C5_AQUCA; Uncharacterized protein | ||||
STRING | EMJ09374 | 2e-18 | (Prunus persica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31762 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G09410.1 | 7e-21 | ethylene induced calmodulin binding protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Tp57577_TGAC_v2_mRNA35519 |