PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium

Family

HSF

Protein Properties

Length: 71aa MW: 8109.09 Da PI: 8.9349

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Tp57577_TGAC_v2_mRNA23619	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	81.5	1.2e-25	13	71	2	60
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+y++++d+++++++sw +n nsfvv+ +f+k++LpkyFkh+nf+SFvRQLn+Y Tp57577_TGAC_v2_mRNA23619 13 FLSKTYDMVDDSSTNTILSWGKNDNSFVVFSAADFSKHILPKYFKHNNFSSFVRQLNTY 71 9*********************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	8.6E-26	8	71	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	3.0E-14	9	71	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	1.77E-21	10	71	IPR011991	Winged helix-turn-helix DNA-binding domain
PRINTS	PR00056	8.5E-17	13	36	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	4.6E-21	13	71	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	8.5E-17	51	63	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	8.5E-17	64	71	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 71 aa Download sequence Send to blast
MTAGSVNYVI TPFLSKTYDM VDDSSTNTIL SWGKNDNSFV VFSAADFSKH ILPKYFKHNN 60 FSSFVRQLNT Y

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5hdk_A	8e-19	10	71	7	68	Heat shock factor protein 2
5hdk_B	8e-19	10	71	7	68	Heat shock factor protein 2
5hdk_C	8e-19	10	71	7	68	Heat shock factor protein 2
5hdk_D	8e-19	10	71	7	68	Heat shock factor protein 2
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Tp57577_TGAC_v2_mRNA23619

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: DNA-binding capacity is reduced by HSBP in vitro. {ECO:0000269\|PubMed:20388662}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012572685.1	5e-35	heat stress transcription factor A-1b isoform X2
Refseq	XP_024638164.1	6e-35	heat stress transcription factor A-1e
Swissprot	O81821	1e-26	HFA1B_ARATH; Heat stress transcription factor A-1b
TrEMBL	A0A2Z6NNC3	2e-38	A0A2Z6NNC3_TRISU; Uncharacterized protein
STRING	XP_004505596.1	2e-37	(Cicer arietinum)
STRING	AES89630	2e-34	(Medicago truncatula)
STRING	AES89639	2e-34	(Medicago truncatula)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1592	33	95

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G16820.2	6e-29	heat shock factor 3

Link Out ? help Back to Top
Phytozome	Tp57577_TGAC_v2_mRNA23619

Publications ? help Back to Top
Hsu SF,Jinn TL AtHSBP functions in seed development and the motif is required for subcellular localization and interaction with AtHSFs. Plant Signal Behav, 2010. 5(8): p. 1042-4 [PMID:20657173] Bechtold U, et al. Arabidopsis HEAT SHOCK TRANSCRIPTION FACTORA1b overexpression enhances water productivity, resistance to drought, and infection. J. Exp. Bot., 2013. 64(11): p. 3467-81 [PMID:23828547] Guan Q,Yue X,Zeng H,Zhu J The protein phosphatase RCF2 and its interacting partner NAC019 are critical for heat stress-responsive gene regulation and thermotolerance in Arabidopsis. Plant Cell, 2014. 26(1): p. 438-53 [PMID:24415771]