PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium

Family

SBP

Protein Properties

Length: 139aa MW: 15997.5 Da PI: 7.4698

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Tp57577_TGAC_v2_mRNA17099	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	132.3	1.7e-41	54	131	1	78
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 +Cqv++C++dls ak+yh+rhkvCe hska +vl+s+l+qrfCqqCsrfh+lsefD+ krsCrrrLa+hnerrrk+++ Tp57577_TGAC_v2_mRNA17099 54 CCQVDNCNVDLSGAKQYHKRHKVCENHSKAHSVLISELQQRFCQQCSRFHDLSEFDDLKRSCRRRLAGHNERRRKSAS 131 6**************************************************************************975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF037575	2.3E-59	1	138	IPR017238	Squamosa promoter-binding protein
Gene3D	G3DSA:4.10.1100.10	7.7E-34	48	116	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	31.701	52	129	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	1.09E-37	52	133	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	1.5E-32	55	128	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009908	Biological Process	flower development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 139 aa Download sequence Send to blast
MDESWGEGKR NYENDYEEEE EEQDLSYGDG KKKRVVNDGY NKKGSKAGGS VPPCCQVDNC 60 NVDLSGAKQY HKRHKVCENH SKAHSVLISE LQQRFCQQCS RFHDLSEFDD LKRSCRRRLA 120 GHNERRRKSA SDYQGEVH*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	2e-35	47	128	3	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Tp57577_TGAC_v2_mRNA17099

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT146337	1e-114	BT146337.1 Medicago truncatula clone JCVI-FLMt-8A17 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003593617.1	1e-64	squamosa promoter-binding protein 1
Swissprot	Q38741	2e-44	SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBL	A0A2Z6MJQ2	6e-82	A0A2Z6MJQ2_TRISU; Squamosa promoter-binding-like protein
STRING	AES63868	6e-64	(Medicago truncatula)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF535	34	153

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G33810.1	2e-39	squamosa promoter binding protein-like 3

Link Out ? help Back to Top
Phytozome	Tp57577_TGAC_v2_mRNA17099

Publications ? help Back to Top
Klein J,Saedler H,Huijser P A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA. Mol. Gen. Genet., 1996. 250(1): p. 7-16 [PMID:8569690]