PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Tp57577_TGAC_v2_mRNA12977

Organism

Trifolium pratense

Taxonomic ID

57577

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium

Family

bZIP

Protein Properties

Length: 311aa MW: 34528.8 Da PI: 10.8308

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Tp57577_TGAC_v2_mRNA12977	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	42.5	1.4e-13	236	283	5	52
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++ N++L+ + e Tp57577_TGAC_v2_mRNA12977 236 RRQRRMIKNRESAARSRARKQAYTVELEAEVAKLKEVNEELQRKQAEF 283 79************************************9987654444 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	3.2E-13	232	296	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.507	234	279	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	1.2E-11	236	288	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	8.5E-14	236	285	No hit	No description
CDD	cd14707	1.02E-25	236	290	No hit	No description
SuperFamily	SSF57959	1.56E-10	236	285	No hit	No description
PROSITE pattern	PS00036	0	239	254	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 311 aa Download sequence Send to blast
XXXXXXXXXX XXXXXXXLTL PRTLSQRKVD EVWRDLMKDS GNSGSSMPQR QTTLGEVTLE 60 EFLVRAGVVK EDAPPPPNHA QQIERPDNNK WFSDFSRSNN NTNLLPFQQP NGNNGNGDLS 120 DNNNLAPKQL PPSSLNPNQS HRPPPLFPKP TNVAFAAPIH LLNNAQLGNP GRSVVPSVGM 180 FGLSAANVVA PVGSPGSKMS PDAITKHNVD PSLPSPVPYG INRGRKGGAV EKVVERRQRR 240 MIKNRESAAR SRARKQAYTV ELEAEVAKLK EVNEELQRKQ AEFLEMQKNK EDLLRTNKIK 300 FLRRTLTGPW *

Functional Description ? help Back to Top
Source	Description
UniProt	Binds to the ABA-responsive element (ABRE). Mediates stress-responsive ABA signaling. {ECO:0000269\|PubMed:11884679, ECO:0000269\|PubMed:15361142}.
UniProt	Involved in ABA and stress responses and acts as a positive component of glucose signal transduction. Functions as transcriptional activator in the ABA-inducible expression of rd29B. Binds specifically to the ABA-responsive element (ABRE) of the rd29B gene promoter. {ECO:0000269\|PubMed:11005831, ECO:0000269\|PubMed:15361142, ECO:0000269\|PubMed:16284313, ECO:0000269\|PubMed:16463099}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Tp57577_TGAC_v2_mRNA12977

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by drought, salt, abscisic acid (ABA), cold and glucose. {ECO:0000269\|PubMed:10636868, ECO:0000269\|PubMed:11005831, ECO:0000269\|PubMed:15361142, ECO:0000269\|PubMed:16284313, ECO:0000269\|PubMed:16463099}.
UniProt	INDUCTION: Up-regulated by drought, salt, abscisic acid (ABA). {ECO:0000269\|PubMed:10636868, ECO:0000269\|PubMed:16284313}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003607958.1	1e-169	ABSCISIC ACID-INSENSITIVE 5-like protein 7
Swissprot	Q9M7Q3	7e-65	AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
Swissprot	Q9M7Q4	5e-65	AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBL	A0A2K3NM69	0.0	A0A2K3NM69_TRIPR; Abscisic acid-insensitive 5-like protein
STRING	AES90155	1e-169	(Medicago truncatula)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1962	34	81

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G45249.1	8e-66	abscisic acid responsive elements-binding factor 2

Link Out ? help Back to Top
Phytozome	Tp57577_TGAC_v2_mRNA12977

Publications ? help Back to Top
Zhao Q, et al. Regulation and function of Arabidopsis AtGALK2 gene in abscisic acid response signaling. Mol. Biol. Rep., 2018. [PMID:24078097] Bao Y, et al. The tumor necrosis factor receptor-associated factor (TRAF)-like family protein SEVEN IN ABSENTIA 2 (SINA2) promotes drought tolerance in an ABA-dependent manner in Arabidopsis. New Phytol., 2014. 202(1): p. 174-87 [PMID:24350984] González-Grandío E,Cubas P Identification of gene functions associated to active and dormant buds in Arabidopsis. Plant Signal Behav, 2014. 9(2): p. e27994 [PMID:24518068] Xie M, et al. AtWNK9 is regulated by ABA and dehydration and is involved in drought tolerance in Arabidopsis. Plant Physiol. Biochem., 2014. 77: p. 73-83 [PMID:24561249] Kim EY,Seo YS,Park KY,Kim SJ,Kim WT Overexpression of CaDSR6 increases tolerance to drought and salt stresses in transgenic Arabidopsis plants. Gene, 2014. 552(1): p. 146-54 [PMID:25234727] Zhang H, et al. The RING finger ubiquitin E3 ligase SDIR1 targets SDIR1-INTERACTING PROTEIN1 for degradation to modulate the salt stress response and ABA signaling in Arabidopsis. Plant Cell, 2015. 27(1): p. 214-27 [PMID:25616872] Baek D, et al. A Role for Arabidopsis miR399f in Salt, Drought, and ABA Signaling. Mol. Cells, 2016. 39(2): p. 111-8 [PMID:26674968] Bao Y, et al. Overexpression of the NDR1/HIN1-Like Gene NHL6 Modifies Seed Germination in Response to Abscisic Acid and Abiotic Stresses in Arabidopsis. PLoS ONE, 2016. 11(2): p. e0148572 [PMID:26849212] Gao S, et al. ABF2, ABF3, and ABF4 Promote ABA-Mediated Chlorophyll Degradation and Leaf Senescence by Transcriptional Activation of Chlorophyll Catabolic Genes and Senescence-Associated Genes in Arabidopsis. Mol Plant, 2016. 9(9): p. 1272-1285 [PMID:27373216] Li X, et al. Dual Function of NAC072 in ABF3-Mediated ABA-Responsive Gene Regulation in Arabidopsis. Front Plant Sci, 2016. 7: p. 1075 [PMID:27486475] Wang Z, et al. Overexpressing Arabidopsis ABF3 increases tolerance to multiple abiotic stresses and reduces leaf size in alfalfa. Plant Physiol. Biochem., 2016. 109: p. 199-208 [PMID:27721135] Seok HY, et al. Arabidopsis AtNAP functions as a negative regulator via repression of AREB1 in salt stress response. Planta, 2017. 245(2): p. 329-341 [PMID:27770200] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Kerr TCC, et al. Ectopic expression of two AREB/ABF orthologs increases drought tolerance in cotton (Gossypium hirsutum). Plant Cell Environ., 2018. 41(5): p. 898-907 [PMID:28098349] Lyzenga WJ,Sullivan V,Liu H,Stone SL The Kinase Activity of Calcineurin B-like Interacting Protein Kinase 26 (CIPK26) Influences Its Own Stability and that of the ABA-regulated Ubiquitin Ligase, Keep on Going (KEG). Front Plant Sci, 2017. 8: p. 502 [PMID:28443108] Song C,Kim T,Chung WS,Lim CO The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions. Mol. Cells, 2017. 40(8): p. 577-586 [PMID:28756655] Fernando VCD,Al Khateeb W,Belmonte MF,Schroeder DF Role of Arabidopsis ABF1/3/4 during det1 germination in salt and osmotic stress conditions. Plant Mol. Biol., 2018. 97(1-2): p. 149-163 [PMID:29680877] Kim HJ, et al. Confirmation of Drought Tolerance of Ectopically Expressed AtABF3 Gene in Soybean. Mol. Cells, 2018. 41(5): p. 413-422 [PMID:29754472]