 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Tp57577_TGAC_v2_mRNA12329 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
Family |
ZF-HD |
Protein Properties |
Length: 86aa MW: 9316.44 Da PI: 8.8418 |
Description |
ZF-HD family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Tp57577_TGAC_v2_mRNA12329 | genome | JGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | ZF-HD_dimer | 105.9 | 2.4e-33 | 16 | 73 | 2 | 60 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
++vrY eC+kNhAa++Gg+avDGC+Efm+s + egt+ al+CaACgCHRnFHRrev++e
Tp57577_TGAC_v2_mRNA12329 16 RNVRYGECQKNHAANIGGYAVDGCREFMAS-NGEGTSGALTCAACGCHRNFHRREVQTE 73
689**************************9.6668********************9876 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:21455630}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AC147201 | 1e-109 | AC147201.19 Medicago truncatula clone mth2-117n1, complete sequence. |
GenBank | BT143007 | 1e-109 | BT143007.1 Medicago truncatula clone JCVI-FLMt-2L7 unknown mRNA. |
GenBank | CU024896 | 1e-109 | CU024896.7 M.truncatula DNA sequence from clone MTH2-150P22 on chromosome 3, complete sequence. |