![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp2g25340 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 207aa MW: 24389.1 Da PI: 9.9534 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 94.2 | 6.1e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien + rqvtfskRrng+lKKA+ELSvLCda+v++iifs++g+lye+s+ Tp2g25340 9 KKIENATSRQVTFSKRRNGLLKKAYELSVLCDAQVSLIIFSQRGRLYEFSN 59 68***********************************************95 PP | |||||||
2 | K-box | 68.2 | 2.6e-23 | 78 | 170 | 5 | 97 |
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 ++++ +e ++l+qe++ + +ie L+ +R+llG++L s+sl+eLq++ +qL++sl k+R++K +l++eq e+l+ kek+l een +L++k Tp2g25340 78 TSNHDSEIYIQQLKQEASHMITKIELLEFHKRKLLGQGLASCSLEELQEIDSQLQRSLGKVRARKAQLFKEQFEKLKAKEKQLLEENVQLHQK 170 3444677889******************999************************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.5E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.156 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.63E-42 | 3 | 78 | No hit | No description |
PRINTS | PR00404 | 7.6E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 8.5E-33 | 3 | 83 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.6E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.6E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.6E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 5.2E-23 | 87 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.149 | 87 | 186 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009838 | Biological Process | abscission | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0080187 | Biological Process | floral organ senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 207 aa Download sequence Send to blast |
MVRGKIEMKK IENATSRQVT FSKRRNGLLK KAYELSVLCD AQVSLIIFSQ RGRLYEFSNT 60 DMQKAIERYR KYTKDHETSN HDSEIYIQQL KQEASHMITK IELLEFHKRK LLGQGLASCS 120 LEELQEIDSQ LQRSLGKVRA RKAQLFKEQF EKLKAKEKQL LEENVQLHQK NVIDPWRGSI 180 DQQEKFRVID LNLEVETDLF IGLPKKH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 3e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 3e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
1tqe_R | 3e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
1tqe_S | 3e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_A | 3e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_B | 3e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_C | 3e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_D | 3e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_E | 3e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
6c9l_F | 3e-22 | 1 | 82 | 1 | 83 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00576 | DAP | Transfer from AT5G62165 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp2g25340 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY054220 | 0.0 | AY054220.1 Arabidopsis thaliana At2g45660/F17K2.19 mRNA, complete cds. | |||
GenBank | AY065206 | 0.0 | AY065206.1 Arabidopsis thaliana unknown protein (At5g62165) mRNA, complete cds. | |||
GenBank | AY066035 | 0.0 | AY066035.1 Arabidopsis thaliana At2g45660/F17K2.19 mRNA, complete cds. | |||
GenBank | AY096509 | 0.0 | AY096509.1 Arabidopsis thaliana unknown protein (At5g62165) mRNA, complete cds. | |||
GenBank | AY141213 | 0.0 | AY141213.1 Arabidopsis thaliana MADS-box protein AGL42 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018461084.1 | 1e-138 | PREDICTED: MADS-box protein AGL42 isoform X1 | ||||
Refseq | XP_018461085.1 | 1e-138 | PREDICTED: MADS-box protein AGL42 isoform X1 | ||||
Swissprot | Q9FIS1 | 1e-135 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A1J3H203 | 1e-140 | A0A1J3H203_NOCCA; MADS-box protein SOC1 | ||||
STRING | Bo2g162920.1 | 1e-136 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 1e-122 | AGAMOUS-like 42 |