PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella

Family

MYB

Protein Properties

Length: 254aa MW: 29205.5 Da PI: 4.7719

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Tp1g16700	genome	thellungiella	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.2	1.7e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd++lv +++++G +W++ +++ g+ R++k+c++rw++yl Tp1g16700 14 KGEWTAEEDQKLVAYINEHGLCDWRSLPKRAGLERCGKSCRLRWLNYL 61 799*******************************************97 PP
2	Myb_DNA-binding	55.5	1.3e-17	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T++E+e ++++++ lG++ W++Ia+ m +Rt++++k++w++ Tp1g16700 67 RGKFTPQEEEDIIKLHAVLGNR-WAAIAKQME-NRTDNDIKNHWNSC 111 89******************.*****.*********975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	14.67	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	3.59E-29	11	108	IPR009057	Homeodomain-like
SMART	SM00717	3.7E-14	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-15	14	61	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	9.0E-24	15	68	IPR009057	Homeodomain-like
CDD	cd00167	2.02E-10	16	61	No hit	No description
PROSITE profile	PS51294	25.835	62	116	IPR017930	Myb domain
SMART	SM00717	2.7E-15	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	3.8E-16	67	111	IPR001005	SANT/Myb domain
CDD	cd00167	2.37E-9	69	109	No hit	No description
Gene3D	G3DSA:1.10.10.60	3.1E-25	69	116	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009651	Biological Process	response to salt stress
GO:0009753	Biological Process	response to jasmonic acid
GO:0005634	Cellular Component	nucleus
GO:0005737	Cellular Component	cytoplasm
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 254 aa Download sequence Send to blast
MGRKTWFDDD GMKKGEWTAE EDQKLVAYIN EHGLCDWRSL PKRAGLERCG KSCRLRWLNY 60 LRPGIKRGKF TPQEEEDIIK LHAVLGNRWA AIAKQMENRT DNDIKNHWNS CLKKRLSRNG 120 IDPMTHEPII NNVTDTTTNE ECGSSSTTME SLSSSSPSGS ACLLNKLATG ISSRQHDLDR 180 IKNILLDPII TSSDQDEEEG LKRDQKTGGG EEDEFLIWDD EEVRRYMETD EMEYETTSYS 240 SFLYESTNIL DHLF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-26	12	116	5	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269\|PubMed:18805951, ECO:0000269\|PubMed:21070410, ECO:0000269\|PubMed:23709630, ECO:0000269\|PubMed:24169067}.
UniProt	Involved in the control of epidermal cell morphogenesis in petals. Promotes unidirectional cell expansion once outgrowth has been initiated (PubMed:17376813). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). Functions as a major regulator of cuticle formation in vegetative organs by regulating the cuticle biosynthesis genes CYP86A8/LCR and CER1 (PubMed:24169067). {ECO:0000269\|PubMed:17376813, ECO:0000269\|PubMed:23709630, ECO:0000269\|PubMed:24169067}.
UniProt	Transcription factor involved in salt stress response. Confers tolerance to salt stress (PubMed:22575450). Involved in distinct cellular processes in response to osmotic stress, including control of primary metabolism and negative regulation of short-term transcriptional responses to osmotic stress (PubMed:19211694). Can activate the steps necessary for aliphatic suberin synthesis and deposition of cell wall-associated suberin-like lamellae. Involved in the production of aliphatic suberin under abiotic stress conditions (PubMed:25060192). {ECO:0000269\|PubMed:19211694, ECO:0000269\|PubMed:22575450, ECO:0000269\|PubMed:25060192}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Tp1g16700

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress (PubMed:19211694, PubMed:25060192). Induced by osmotic stress (PubMed:19211694). Induced by abscisic acid (PubMed:25060192). {ECO:0000269\|PubMed:19211694, ECO:0000269\|PubMed:25060192}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF974753	0.0	KF974753.1 Brassica napus MYB transcription factor 47 (MYB47.1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013602606.1	1e-154	PREDICTED: transcription factor MYB34-like isoform X1
Swissprot	Q9LE63	5e-59	MY106_ARATH; Transcription factor MYB106
Swissprot	Q9LXF1	3e-59	MYB16_ARATH; Transcription factor MYB16
Swissprot	Q9M0J5	9e-60	MYB41_ARATH; Transcription factor MYB41
TrEMBL	A0A3P6EEK5	1e-155	A0A3P6EEK5_BRAOL; Uncharacterized protein
STRING	Bo5g025730.1	1e-153	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G18710.1	1e-115	myb domain protein 47

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang BH, et al. Positive selection and functional divergence of R2R3-MYB paralogous genes expressed in inflorescence buds of Scutellaria species (Labiatae). Int J Mol Sci, 2015. 16(3): p. 5900-21 [PMID:25782156] Cui F, et al. Dissecting Abscisic Acid Signaling Pathways Involved in Cuticle Formation. Mol Plant, 2016. 9(6): p. 926-38 [PMID:27060495]