![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10026205m | ||||||||
Common Name | EUTSA_v10026205mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 218aa MW: 25067.9 Da PI: 7.2532 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89.2 | 2.1e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRr+g+lKKA+ELSvLCda+va i+fs++g+ly+++s Thhalv10026205m 9 KRIENVTSRQVTFSKRRKGLLKKAHELSVLCDAQVAAIVFSQNGRLYDFAS 59 79***********************************************86 PP | |||||||
2 | K-box | 50.7 | 7.5e-18 | 80 | 174 | 9 | 100 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk...ekelqeenkaLrkkle 99 ++++ ++l++e+a + ++ie Lq R+l+G+dL+s+s+ eL+++ ++eksl+ +Rs+K +l ++ie+ + e+e+ +e +Lr+++e Thhalv10026205m 80 QKQQYVQELKNEMAIMVDKIELLQLHCRKLMGQDLDSCSVDELKEITIKIEKSLTIVRSRKAKLSEDEIEKETAQiagEREVLDERSRLRQMFE 173 5677889*****************999******************************************9876544448899999999999887 PP K-box 100 e 100 e Thhalv10026205m 174 E 174 6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 5.2E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.581 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 7.85E-31 | 3 | 82 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.59E-39 | 3 | 68 | No hit | No description |
Pfam | PF00319 | 1.3E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 3.7E-17 | 82 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 11.933 | 85 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 218 aa Download sequence Send to blast |
MVRGKIEIKR IENVTSRQVT FSKRRKGLLK KAHELSVLCD AQVAAIVFSQ NGRLYDFASS 60 DMQKMMERQY REYFGAEILQ KQQYVQELKN EMAIMVDKIE LLQLHCRKLM GQDLDSCSVD 120 ELKEITIKIE KSLTIVRSRK AKLSEDEIEK ETAQIAGERE VLDERSRLRQ MFEEKPLWMQ 180 SRNLESDKSA PSCGCGNMNV SDVETDLSIG LPESRVQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 9e-19 | 1 | 73 | 1 | 72 | MEF2C |
5f28_B | 9e-19 | 1 | 73 | 1 | 72 | MEF2C |
5f28_C | 9e-19 | 1 | 73 | 1 | 72 | MEF2C |
5f28_D | 9e-19 | 1 | 73 | 1 | 72 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10026205m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189309 | 4e-63 | AC189309.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB034C07, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006413306.1 | 1e-158 | MADS-box protein AGL72 | ||||
Swissprot | Q9FLH5 | 8e-74 | AGL72_ARATH; MADS-box protein AGL72 | ||||
TrEMBL | V4ME59 | 1e-157 | V4ME59_EUTSA; Uncharacterized protein | ||||
STRING | XP_006413306.1 | 1e-158 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM8805 | 12 | 35 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51860.2 | 5e-79 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10026205m |
Entrez Gene | 18030353 |
Publications ? help Back to Top | |||
---|---|---|---|
|