PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema

Family

MIKC_MADS

Protein Properties

Length: 218aa MW: 25067.9 Da PI: 7.2532

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Thhalv10026205m	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	89.2	2.1e-28	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRr+g+lKKA+ELSvLCda+va i+fs++g+ly+++s Thhalv10026205m 9 KRIENVTSRQVTFSKRRKGLLKKAHELSVLCDAQVAAIVFSQNGRLYDFAS 59 79***********************************************86 PP
2	K-box	50.7	7.5e-18	80	174	9	100
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk...ekelqeenkaLrkkle 99 ++++ ++l++e+a + ++ie Lq R+l+G+dL+s+s+ eL+++ ++eksl+ +Rs+K +l ++ie+ + e+e+ +e +Lr+++e Thhalv10026205m 80 QKQQYVQELKNEMAIMVDKIELLQLHCRKLMGQDLDSCSVDELKEITIKIEKSLTIVRSRKAKLSEDEIEKETAQiagEREVLDERSRLRQMFE 173 5677889***************999****************************************9876544448899999999999887 PP K-box 100 e 100 e Thhalv10026205m 174 E 174 6 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	5.2E-40	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	31.581	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	7.85E-31	3	82	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.9E-29	3	23	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.59E-39	3	68	No hit	No description
Pfam	PF00319	1.3E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.9E-29	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.9E-29	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	3.7E-17	82	172	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	11.933	85	178	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 218 aa Download sequence Send to blast
MVRGKIEIKR IENVTSRQVT FSKRRKGLLK KAHELSVLCD AQVAAIVFSQ NGRLYDFASS 60 DMQKMMERQY REYFGAEILQ KQQYVQELKN EMAIMVDKIE LLQLHCRKLM GQDLDSCSVD 120 ELKEITIKIE KSLTIVRSRK AKLSEDEIEK ETAQIAGERE VLDERSRLRQ MFEEKPLWMQ 180 SRNLESDKSA PSCGCGNMNV SDVETDLSIG LPESRVQ*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	9e-19	1	73	1	72	MEF2C
5f28_B	9e-19	1	73	1	72	MEF2C
5f28_C	9e-19	1	73	1	72	MEF2C
5f28_D	9e-19	1	73	1	72	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269\|PubMed:21609362}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Thhalv10026205m

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC189309	4e-63	AC189309.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB034C07, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006413306.1	1e-158	MADS-box protein AGL72
Swissprot	Q9FLH5	8e-74	AGL72_ARATH; MADS-box protein AGL72
TrEMBL	V4ME59	1e-157	V4ME59_EUTSA; Uncharacterized protein
STRING	XP_006413306.1	1e-158	(Eutrema salsugineum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM8805	12	35

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G51860.2	5e-79	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	Thhalv10026205m
Entrez Gene	18030353

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]