PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10019669m | ||||||||
Common Name | EUTSA_v10019669mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 232aa MW: 26728.9 Da PI: 9.8553 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.3 | 8.6e-19 | 4 | 49 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l+d+v+q+G+++W++Ia +++ gR++k+c++rw++ Thhalv10019669m 4 RGHWRPAEDEKLKDLVEQYGPHNWNAIALKLP-GRSGKSCRLRWFNQ 49 899*****************************.***********996 PP | |||||||
2 | Myb_DNA-binding | 60.6 | 3.3e-19 | 56 | 99 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r+++T+eE+e+l+ a++ +G++ W+ Iar ++ gRt++ +k++w+ Thhalv10019669m 56 RNPFTEEEEERLLAAHRIHGNR-WSIIARLFP-GRTDNAVKNHWHV 99 789*******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 19.673 | 1 | 50 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-15 | 3 | 52 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-17 | 4 | 49 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.18E-30 | 4 | 97 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.3E-27 | 5 | 57 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.18E-15 | 7 | 48 | No hit | No description |
PROSITE profile | PS51294 | 26.379 | 51 | 105 | IPR017930 | Myb domain |
SMART | SM00717 | 1.9E-16 | 55 | 103 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.4E-16 | 56 | 98 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.8E-22 | 58 | 104 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.31E-7 | 67 | 98 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:2000652 | Biological Process | regulation of secondary cell wall biogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 232 aa Download sequence Send to blast |
MCSRGHWRPA EDEKLKDLVE QYGPHNWNAI ALKLPGRSGK SCRLRWFNQL DPRINRNPFT 60 EEEEERLLAA HRIHGNRWSI IARLFPGRTD NAVKNHWHVI MARRTRQTSK PRLVPSTTSS 120 SSLTGTEQIM SSSCDRKRIL GDVISYPYQF SHINHLQFLK EFFNGKIALN TKANQSKKPM 180 EFYNFLQVNT DSNKSEVIDQ DVDQSNSNNQ DYSNESRVPF FDFLSVGNSA S* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1mse_C | 5e-32 | 1 | 105 | 1 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 5e-32 | 1 | 105 | 1 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers. {ECO:0000269|PubMed:18952777}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10019669m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF062890 | 1e-145 | AF062890.1 Arabidopsis thaliana putative transcription factor (MYB54) mRNA, complete cds. | |||
GenBank | AK227402 | 1e-145 | AK227402.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-06-B21. | |||
GenBank | AY519569 | 1e-145 | AY519569.1 Arabidopsis thaliana MYB transcription factor (At1g73410) mRNA, complete cds. | |||
GenBank | BT024851 | 1e-145 | BT024851.1 Arabidopsis thaliana At1g73410 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006390559.1 | 1e-174 | transcription factor MYB54 | ||||
Swissprot | Q9FX36 | 1e-139 | MYB54_ARATH; Transcription factor MYB54 | ||||
TrEMBL | V4JRF1 | 1e-173 | V4JRF1_EUTSA; Uncharacterized protein | ||||
STRING | XP_006390559.1 | 1e-174 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2818 | 27 | 69 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G73410.1 | 1e-129 | myb domain protein 54 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10019669m |
Entrez Gene | 18008993 |
Publications ? help Back to Top | |||
---|---|---|---|
|