 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Thhalv10017480m |
| Common Name | EUTSA_v10017480mg |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
| Family |
MYB_related |
| Protein Properties |
Length: 93aa MW: 11543.1 Da PI: 9.9509 |
| Description |
MYB_related family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Thhalv10017480m | genome | JGI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 23.6 | 1.2e-07 | 36 | 75 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
+T++E++l+ + ++ G++ W++Ia ++ +R ++++ +w
Thhalv10017480m 36 MTEQEEDLIFRMYRLVGNR-WDLIAGRVA-RREANEIERYWI 75
79*****************.*********.***********5 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated |
| GO:0080147 | Biological Process | root hair cell development |
| GO:1900033 | Biological Process | negative regulation of trichome patterning |
| GO:0005634 | Cellular Component | nucleus |
| GO:0003677 | Molecular Function | DNA binding |
| Nucleic Localization
Signal ? help
Back to Top |
 |
| No. |
Start |
End |
Sequence |
| 1 | 5 | 12 | RLRRLRSR |
| 2 | 7 | 14 | RRLRSRKQ |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15604688, ECO:0000269|PubMed:19818620}. |
| UniProt | MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation. May function by suppressing the expression of GL3. {ECO:0000269|PubMed:22168948}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AY234411 | 4e-64 | AY234411.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds. |
| GenBank | AY519520 | 4e-64 | AY519520.1 Arabidopsis thaliana MYB transcription factor (At2g30420) mRNA, complete cds. |
| GenBank | AY649255 | 4e-64 | AY649255.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds. |
| Publications
? help Back to Top |
- Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
Mol. Biol. Evol., 2006. 23(2): p. 469-78
[PMID:16280546] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444] - Wada T,Hayashi N,Tominaga-Wada R
Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis.
Plant Signal Behav, 2015. 10(11): p. e1089372
[PMID:26339713] - Huang M,Hu Y,Liu X,Li Y,Hou X
Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development.
Front Plant Sci, 2015. 6: p. 955
[PMID:26579186] - Wada T,Tominaga-Wada R
CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression.
Plant Sci., 2015. 241: p. 260-5
[PMID:26706076] - Tominaga-Wada R,Wada T
Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation.
Development, 2017. 144(13): p. 2375-2380
[PMID:28676568] - Yamada K,Sasabe M,Fujikawa Y,Wada T,Tominaga-Wada R
Amino acid substitutions in CPC-LIKE MYB reveal residues important for protein stability in Arabidopsis roots.
PLoS ONE, 2018. 13(10): p. e0205522
[PMID:30308079]
|
