PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema

Family

YABBY

Protein Properties

Length: 110aa MW: 12033.7 Da PI: 10.934

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Thhalv10017459m	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	47.2	8.8e-15	2	45	23	67
YABBY 23 avsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldesl 67 vsvP +slf +vtvrCGhCt+l svn+ a q l+ + + + Thhalv10017459m 2 KVSVPCSSLFDIVTVRCGHCTNLWSVNMVAALQSLSRPNF-QATN 45 69**************************999988877664.2222 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	7.8E-16	2	64	IPR006780	YABBY protein

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009944	Biological Process	polarity specification of adaxial/abaxial axis
GO:1902183	Biological Process	regulation of shoot apical meristem development
GO:2000024	Biological Process	regulation of leaf development

Sequence ? help Back to Top
Protein Sequence Length: 110 aa Download sequence Send to blast
MKVSVPCSSL FDIVTVRCGH CTNLWSVNMV AALQSLSRPN FQATNYAMSE HGSSSRGHTK 60 IPSRISTRTI TEQRVVNRRK PLSPSRKAAA STFCLQSIHK RGNSEDQGE*

Functional Description ? help Back to Top
Source	Description
UniProt	Promotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269\|PubMed:19837869}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Thhalv10017459m

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK353291	1e-139	AK353291.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-24-G08.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024004272.1	1e-50	axial regulator YABBY 5 isoform X3
Swissprot	Q8GW46	6e-46	YAB5_ARATH; Axial regulator YABBY 5
TrEMBL	V4LKW3	3e-75	V4LKW3_EUTSA; Uncharacterized protein
STRING	XP_006409726.1	9e-49	(Eutrema salsugineum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G26580.2	2e-48	YABBY family protein

Link Out ? help Back to Top
Phytozome	Thhalv10017459m
Entrez Gene	18027619

Publications ? help Back to Top
Husbands AY,Benkovics AH,Nogueira FT,Lodha M,Timmermans MC The ASYMMETRIC LEAVES Complex Employs Multiple Modes of Regulation to Affect Adaxial-Abaxial Patterning and Leaf Complexity. Plant Cell, 2015. 27(12): p. 3321-35 [PMID:26589551]