PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema

Family

MYB_related

Protein Properties

Length: 178aa MW: 20256.5 Da PI: 5.7292

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Thhalv10014818m	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	52	1.6e-16	2	43	5	48
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +++E+ l +++++++G++ W++Iar+++ gRt++++k++w++++ Thhalv10014818m 2 SPQEERLVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 43 89**************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.33	1	47	IPR017930	Myb domain
SMART	SM00717	6.1E-12	1	45	IPR001005	SANT/Myb domain
CDD	cd00167	1.22E-12	1	43	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.4E-20	2	44	IPR009057	Homeodomain-like
Pfam	PF00249	7.2E-15	2	42	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.33E-12	2	48	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009723	Biological Process	response to ethylene
GO:0009739	Biological Process	response to gibberellin
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0010200	Biological Process	response to chitin
GO:0046686	Biological Process	response to cadmium ion
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 178 aa Download sequence Send to blast
MSPQEERLVL ELHAKWGNRW SKIARKLPGR TDNEIKNYWR THMRKKAQEK KRPMSPTSSS 60 SNCCSSSMTT ATTDQDTGGS NGNMNQECED GYYSMDDIWR EIDQSGANII KPVKDIYYSE 120 QSCYLNFTPP LTSPTWESSL ESIWNMDAAD ESKMSSFAID QFPLSFQHGR SSWSSLV*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00600	PBM	Transfer from AT5G59780	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Thhalv10014818m

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:16531467}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK229048	0.0	AK229048.1 Arabidopsis thaliana mRNA for MYB27 protein - like, complete cds, clone: RAFL16-34-F17.
GenBank	AY519641	0.0	AY519641.1 Arabidopsis thaliana MYB transcription factor (At5g59780) mRNA, complete cds.
GenBank	DQ075252	0.0	DQ075252.1 Arabidopsis thaliana MYB transcription factor MYB59-1 (At5g59780) mRNA, complete cds, alternatively spliced.
GenBank	DQ075253	0.0	DQ075253.1 Arabidopsis thaliana MYB transcription factor MYB59-2 (At5g59780) mRNA, complete cds, alternatively spliced.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006400917.1	1e-130	transcription factor MYB59 isoform X2
Refseq	XP_006400918.1	1e-130	transcription factor MYB59 isoform X1
Swissprot	Q4JL84	1e-100	MYB59_ARATH; Transcription factor MYB59
TrEMBL	V4LF57	1e-130	V4LF57_EUTSA; Uncharacterized protein
STRING	XP_006400918.1	1e-129	(Eutrema salsugineum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G59780.1	3e-97	myb domain protein 59

Link Out ? help Back to Top
Phytozome	Thhalv10014818m
Entrez Gene	18017308

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Nishida S,Kakei Y,Shimada Y,Fujiwara T Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana. Plant J., 2017. 91(4): p. 741-753 [PMID:28586097] Hickman R, et al. Architecture and Dynamics of the Jasmonic Acid Gene Regulatory Network. Plant Cell, 2017. 29(9): p. 2086-2105 [PMID:28827376]