![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10005497m | ||||||||
Common Name | EUTSA_v10005497mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 122aa MW: 13815 Da PI: 8.6728 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 127.9 | 4.7e-40 | 5 | 104 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 +CaaCk+lrr+C+kdC+++pyfp ++p kfa++h+++Ga nv+k+l++lp ++r +a++sl++eA++r++dPvyG+vg+i lq q++++++ l Thhalv10005497m 5 RCAACKYLRRRCPKDCFFSPYFPPNDPDKFAYIHRIYGAGNVSKMLQQLPVQTRAEAVDSLCFEAKCRVEDPVYGCVGIIYFLQTQIQKTESLL 98 6*******************************************************************************************99 PP DUF260 95 allkee 100 a++++e Thhalv10005497m 99 AKTQAE 104 999887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 23.584 | 4 | 105 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 4.9E-39 | 5 | 102 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0016020 | Cellular Component | membrane |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MNPKRCAACK YLRRRCPKDC FFSPYFPPND PDKFAYIHRI YGAGNVSKML QQLPVQTRAE 60 AVDSLCFEAK CRVEDPVYGC VGIIYFLQTQ IQKTESLLAK TQAEIAVAQI KHSQAQNSEF 120 M* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 9e-36 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 9e-36 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10005497m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB473846 | 1e-110 | AB473846.1 Arabidopsis thaliana ASL13 mRNA for ASYMMETRIC LEAVES2-like 13 protein, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006395539.1 | 7e-87 | LOB domain-containing protein 24 | ||||
Swissprot | P59468 | 1e-74 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
TrEMBL | V4K5H8 | 2e-85 | V4K5H8_EUTSA; Uncharacterized protein | ||||
STRING | XP_006395539.1 | 3e-86 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 5e-77 | LOB domain-containing protein 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10005497m |
Entrez Gene | 18011666 |