PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10005428m | ||||||||
Common Name | EUTSA_v10005428mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 220aa MW: 25509.6 Da PI: 9.7681 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.2 | 3e-16 | 18 | 65 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd +l d+v +G+g+W++I r g++R++k+c++rw +yl Thhalv10005428m 18 KGLWTVEEDNILRDYVLAHGKGQWNRIVRNTGLKRCGKSCRLRWINYL 65 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 61 | 2.6e-19 | 71 | 116 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g +T++E++l+++++k+lG++ W++Ia++++ gRt++q+k++w+++l Thhalv10005428m 71 KGDFTEQEEDLIIRLHKLLGNR-WSLIAKRVP-GRTDNQVKNHWNTHL 116 689*******************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.998 | 13 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.15E-30 | 16 | 112 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.5E-13 | 17 | 67 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.2E-14 | 18 | 65 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.0E-22 | 19 | 72 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.29E-9 | 21 | 65 | No hit | No description |
PROSITE profile | PS51294 | 28.622 | 66 | 120 | IPR017930 | Myb domain |
SMART | SM00717 | 6.8E-19 | 70 | 118 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.7E-18 | 71 | 116 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-26 | 73 | 119 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.61E-13 | 74 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0001708 | Biological Process | cell fate specification | ||||
GO:0032880 | Biological Process | regulation of protein localization | ||||
GO:0048629 | Biological Process | trichome patterning | ||||
GO:2000039 | Biological Process | regulation of trichome morphogenesis | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 220 aa Download sequence Send to blast |
MRTRRRSKGK ENHQEYKKGL WTVEEDNILR DYVLAHGKGQ WNRIVRNTGL KRCGKSCRLR 60 WINYLSPNVN KGDFTEQEED LIIRLHKLLG NRWSLIAKRV PGRTDNQVKN HWNTHLRKKT 120 IGDNSPAVVT TTGDGDSPPS LFNNTAKTYS HHQRDNAAKN LDGVVSKPSY EEDKSKVDWQ 180 KSLYFEEKNN CYSSNAFWAN ELNEFDLSSL LMMDFAYCL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-27 | 18 | 120 | 7 | 108 | B-MYB |
1h8a_C | 2e-27 | 15 | 120 | 24 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in leaves. Together with TTG1 and GL3, promotes trichome formation and endoreplication. Regulates the production of a signal that induces hair (trichome) precursor cells on leaf primordia to differentiate. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes (By similarity). {ECO:0000250, ECO:0000269|PubMed:11063707, ECO:0000269|PubMed:12356720, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15728674, ECO:0000269|PubMed:9625690}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Thhalv10005428m |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by gibberellins (PubMed:9625690). May be regulated by GEBP and GEBP-like proteins (PubMed:12535344). {ECO:0000269|PubMed:12535344, ECO:0000269|PubMed:9625690}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF495524 | 1e-129 | AF495524.1 Arabidopsis thaliana R2R3-MYB transcription factor GL1 (MYB0) mRNA, complete cds. | |||
GenBank | AY519590 | 1e-129 | AY519590.1 Arabidopsis thaliana MYB transcription factor (At3g27920) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024006865.1 | 1e-159 | LOW QUALITY PROTEIN: trichome differentiation protein GL1 | ||||
Swissprot | P27900 | 4e-96 | GL1_ARATH; Trichome differentiation protein GL1 | ||||
TrEMBL | V4KRP3 | 1e-163 | V4KRP3_EUTSA; Uncharacterized protein | ||||
STRING | XP_006395391.1 | 1e-164 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27920.1 | 2e-98 | myb domain protein 0 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10005428m |
Entrez Gene | 18011961 |