 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Thhalv10005181m |
Common Name | EUTSA_v10005181mg |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
Family |
GATA |
Protein Properties |
Length: 102aa MW: 11232.2 Da PI: 10.2667 |
Description |
GATA family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Thhalv10005181m | genome | JGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | GATA | 60.3 | 2.5e-19 | 11 | 45 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
Cs C+ttkTp+WR gp+g+k+LCnaCG++ rk+++
Thhalv10005181m 11 CSDCKTTKTPMWRGGPSGPKSLCNACGIRLRKQRR 45
********************************985 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
GO:0009416 | Biological Process | response to light stimulus |
GO:0048527 | Biological Process | lateral root development |
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
GO:0008270 | Molecular Function | zinc ion binding |
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | DQ446989 | 2e-84 | DQ446989.1 Arabidopsis thaliana clone pENTR221-At5g26930 zinc finger family protein (At5g26930) mRNA, complete cds. |