PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Thhalv10004769m

Common Name

EUTSA_v10004769mg

Organism

Eutrema salsugineum

Taxonomic ID

72664

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema

Family

MIKC_MADS

Protein Properties

Length: 270aa MW: 30944.4 Da PI: 10.1032

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Thhalv10004769m	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	97.3	6.2e-31	37	87	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fss+gkl+eys+ Thhalv10004769m 37 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSSKGKLFEYST 87 79***********************************************96 PP
2	K-box	103.9	2.1e-34	106	202	4	100
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 ++ + + +++e++ e+akLk+++e L++++R+++GedL+sLslkeLq+Le+qL+ ++k+iRs+Kn+ ++e+i+ lqkk k+lq++n++L kk Thhalv10004769m 106 KQLVGRDISQSENWVLEHAKLKARVEVLEKNKRNFMGEDLDSLSLKELQSLEHQLDAAIKSIRSRKNQAMFESISALQKKDKALQDHNNTLLKK 199 56666778899*********************************************************************************** PP K-box 98 lee 100 ++e Thhalv10004769m 200 IKE 202 987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.688	29	89	IPR002100	Transcription factor, MADS-box
SMART	SM00432	8.5E-41	29	88	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.82E-40	30	107	No hit	No description
SuperFamily	SSF55455	2.75E-33	30	119	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.4E-31	31	51	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	31	85	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.3E-25	38	85	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.4E-31	51	66	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.4E-31	66	87	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	9.8E-29	114	200	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	15.766	116	206	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010077	Biological Process	maintenance of inflorescence meristem identity
GO:0010154	Biological Process	fruit development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 270 aa Download sequence Send to blast
MARKRPYGLS FLPLVLEVLR REREREREMG RGRVQLKRIE NKINRQVTFS KRRSGLLKKA 60 HEISVLCDAE VALIVFSSKG KLFEYSTDSC MERILERYDR YLYSDKQLVG RDISQSENWV 120 LEHAKLKARV EVLEKNKRNF MGEDLDSLSL KELQSLEHQL DAAIKSIRSR KNQAMFESIS 180 ALQKKDKALQ DHNNTLLKKI KEREKKSGQQ EGQLIQCSNN SSILQPQYCV TATRDGFEGR 240 VGGENGGASS LTEPNSLLPA WMLRPTTTE*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	6e-22	29	118	1	89	MEF2C
5f28_B	6e-22	29	118	1	89	MEF2C
5f28_C	6e-22	29	118	1	89	MEF2C
5f28_D	6e-22	29	118	1	89	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1 and CAULIFLOWER. Is required subsequently for the transition of an inflorescence meristem into a floral meristem (PubMed:28586421). Seems to be partially redundant to the function of APETALA1 and CAULIFLOWER in the up-regulation of LEAFY. Is also required for normal pattern of cell division, expansion and differentiation during morphogenesis of the silique (PubMed:28586421). Probably not required for fruit elongation but instead is required to prevent ectopic activity of IND. Represses SAUR10 expression in stems and inflorescence branches (PubMed:28586421). {ECO:0000269\|PubMed:10648231, ECO:0000269\|PubMed:15035986, ECO:0000269\|PubMed:28586421, ECO:0000269\|PubMed:9502732}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Thhalv10004769m

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Dramatically up-regulated upon the transition from vegetative to reproductive development.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF386929	0.0	AF386929.1 Arabidopsis thaliana floral homeotic protein AGL8 (MSL3.3) mRNA, complete cds.
GenBank	ATU33473	0.0	U33473.1 Arabidopsis thaliana agamous-like 8 (AGL8) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024006932.1	1e-178	agamous-like MADS-box protein AGL8
Swissprot	Q38876	1e-171	AGL8_ARATH; Agamous-like MADS-box protein AGL8
TrEMBL	V4MK96	0.0	V4MK96_EUTSA; Uncharacterized protein
STRING	XP_006394555.1	0.0	(Eutrema salsugineum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM792	25	110

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60910.1	1e-158	AGAMOUS-like 8

Link Out ? help Back to Top
Phytozome	Thhalv10004769m
Entrez Gene	18013169

Publications ? help Back to Top
Yu Y, et al. MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering. Plant Sci., 2013. 212: p. 1-9 [PMID:24094048] Pabón-Mora N,Wong GK,Ambrose BA Evolution of fruit development genes in flowering plants. Front Plant Sci, 2014. 5: p. 300 [PMID:25018763] Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons. GM Crops Food, 2014. 5(4): p. 302-20 [PMID:25523176] Wang C,Dehesh K From retrograde signaling to flowering time. Plant Signal Behav, 2015. 10(6): p. e1022012 [PMID:26098376] Borghi M,Xie DY Tissue-specific production of limonene in Camelina sativa with the Arabidopsis promoters of genes BANYULS and FRUITFULL. Planta, 2016. 243(2): p. 549-61 [PMID:26530959] Yu Y, et al. WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana. Plant J., 2016. 85(1): p. 96-106 [PMID:26643131] McCarthy EW,Mohamed A,Litt A Functional Divergence of APETALA1 and FRUITFULL is due to Changes in both Regulation and Coding Sequence. Front Plant Sci, 2015. 6: p. 1076 [PMID:26697035] Davin N, et al. Functional network analysis of genes differentially expressed during xylogenesis in soc1ful woody Arabidopsis plants. Plant J., 2016. 86(5): p. 376-90 [PMID:26952251] Hyun Y, et al. Multi-layered Regulation of SPL15 and Cooperation with SOC1 Integrate Endogenous Flowering Pathways at the Arabidopsis Shoot Meristem. Dev. Cell, 2016. 37(3): p. 254-66 [PMID:27134142] José Ripoll J, et al. microRNA regulation of fruit growth. Nat Plants, 2015. 1(4): p. 15036 [PMID:27247036] Li W,Wang H,Yu D Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions. Mol Plant, 2016. 9(11): p. 1492-1503 [PMID:27592586] Eldridge T, et al. Fruit shape diversity in the Brassicaceae is generated by varying patterns of anisotropy. Development, 2016. 143(18): p. 3394-406 [PMID:27624834] Bemer M, et al. FRUITFULL controls SAUR10 expression and regulates Arabidopsis growth and architecture. J. Exp. Bot., 2017. 68(13): p. 3391-3403 [PMID:28586421] Sehra B,Franks RG Redundant CArG Box Cis-motif Activity Mediates SHATTERPROOF2 Transcriptional Regulation during Arabidopsis thaliana Gynoecium Development. Front Plant Sci, 2017. 8: p. 1712 [PMID:29085379] Balanzà V, et al. Genetic control of meristem arrest and life span in Arabidopsis by a FRUITFULL-APETALA2 pathway. Nat Commun, 2018. 9(1): p. 565 [PMID:29422669]