PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema

Family

WRKY

Protein Properties

Length: 99aa MW: 11811.6 Da PI: 10.2623

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Thhalv10001738m	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	103	1.7e-32	17	75	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+s +prsYYrCt++ C+vkk+v+r +++ ++ve+tYeg Hnh+ Thhalv10001738m 17 LDDGYRWRKYGQKSVKNSLYPRSYYRCTQHMCNVKKQVQRLSKERSIVETTYEGIHNHP 75 59********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	1.0E-32	2	75	IPR003657	WRKY domain
SuperFamily	SSF118290	3.01E-28	10	76	IPR003657	WRKY domain
PROSITE profile	PS50811	27.451	12	77	IPR003657	WRKY domain
SMART	SM00774	2.7E-36	17	76	IPR003657	WRKY domain
Pfam	PF03106	2.8E-26	18	75	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 99 aa Download sequence Send to blast
MKKSRFAFRT KSDKDILDDG YRWRKYGQKS VKNSLYPRSY YRCTQHMCNV KKQVQRLSKE 60 RSIVETTYEG IHNHPCEEIM QTLTPLLHQM KFLSNFTS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	9e-25	7	74	7	74	Probable WRKY transcription factor 4
2lex_A	9e-25	7	74	7	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00317	DAP	Transfer from AT2G46130	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Thhalv10001738m

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF404861	1e-103	AF404861.1 Arabidopsis thaliana WRKY transcription factor 43 splice variant one (WRKY43) mRNA, complete cds; alternatively spliced.
GenBank	AK117931	1e-103	AK117931.1 Arabidopsis thaliana At2g46130 mRNA for putative WRKY transcription factor (WRKY43), complete cds, clone: RAFL19-12-A14.
GenBank	BT004701	1e-103	BT004701.1 Arabidopsis thaliana At2g46130 gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006397797.2	1e-69	probable WRKY transcription factor 43 isoform X2
Swissprot	Q8GY11	5e-64	WRK43_ARATH; Probable WRKY transcription factor 43
TrEMBL	V4KMW8	2e-68	V4KMW8_EUTSA; Uncharacterized protein
STRING	XP_006397797.1	4e-69	(Eutrema salsugineum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM509	28	154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G46130.1	2e-66	WRKY DNA-binding protein 43

Link Out ? help Back to Top
Phytozome	Thhalv10001738m
Entrez Gene	18015833

Publications ? help Back to Top
Geilen K,Heilmann M,Hillmer S,Böhmer M WRKY43 regulates polyunsaturated fatty acid content and seed germination under unfavourable growth conditions. Sci Rep, 2017. 7(1): p. 14235 [PMID:29079824]