PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma

Family

HD-ZIP

Protein Properties

Length: 221aa MW: 25833.2 Da PI: 8.5822

Description

HD-ZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Thecc1EG022391t1	genome	CGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	60.1	3.5e-19	60	113	3	56
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 k+ ++t++ql+ Le+ F+++ +++ +++ +L+++lgL+ rq+ vWFqNrRa++k Thecc1EG022391t1 60 KKKRLTTDQLDSLERSFQEEIKLDPDRKMKLSRELGLQPRQIAVWFQNRRARWK 113 56779************************************************9 PP
2	HD-ZIP_I/II	118.8	2.8e-38	59	150	1	92
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 ekk+rl+++q+ +LE+sF+ee kL+p+rK++l+reLglqprq+avWFqnrRAR+k+kqlE+ y+aLk++yd +++e+++L++ev +L+ l+ Thecc1EG022391t1 59 EKKKRLTTDQLDSLERSFQEEIKLDPDRKMKLSRELGLQPRQIAVWFQNRRARWKAKQLERLYDALKQEYDVISREKQKLQEEVMKLKGMLR 150 69*************************************************************************************98776 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	1.41E-18	51	117	IPR009057	Homeodomain-like
PROSITE profile	PS50071	17.459	55	115	IPR001356	Homeobox domain
SMART	SM00389	7.3E-17	58	119	IPR001356	Homeobox domain
Pfam	PF00046	2.1E-16	60	113	IPR001356	Homeobox domain
CDD	cd00086	1.25E-15	60	116	No hit	No description
Gene3D	G3DSA:1.10.10.60	3.2E-20	65	114	IPR009057	Homeodomain-like
PRINTS	PR00031	3.8E-5	86	95	IPR000047	Helix-turn-helix motif
PROSITE pattern	PS00027	0	90	113	IPR017970	Homeobox, conserved site
PRINTS	PR00031	3.8E-5	95	111	IPR000047	Helix-turn-helix motif
Pfam	PF02183	6.1E-9	115	149	IPR003106	Leucine zipper, homeobox-associated

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009965	Biological Process	leaf morphogenesis
GO:0010434	Biological Process	bract formation
GO:0010582	Biological Process	floral meristem determinacy
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0048510	Biological Process	regulation of timing of transition from vegetative to reproductive phase
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 221 aa Download sequence Send to blast
MDWNGTLRTF VSRPEPSLNF LYNYNYDQYP GMEMKHPGLV EAVHGLVPAL DKNSYNNQEK 60 KKRLTTDQLD SLERSFQEEI KLDPDRKMKL SRELGLQPRQ IAVWFQNRRA RWKAKQLERL 120 YDALKQEYDV ISREKQKLQE EVMKLKGMLR EQATKNPGST GYTDMSGEET VESTSIRCSN 180 KPRVVANHHH QIAECNYVFN VDEYNPISSP YWAVQLPSYP *

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	107	115	RRARWKAKQ

Functional Description ? help Back to Top
Source	Description
UniProt	Putative transcription factor. {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00486	DAP	Transfer from AT5G03790	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007027573.2	1e-163	PREDICTED: putative homeobox-leucine zipper protein ATHB-51 isoform X1
Swissprot	Q9LZR0	1e-57	ATB51_ARATH; Putative homeobox-leucine zipper protein ATHB-51
TrEMBL	A0A061ESP9	1e-165	A0A061ESP9_THECC; Homeobox-leucine zipper protein ATHB-51
STRING	EOY08075	1e-166	(Theobroma cacao)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1660	28	88

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G03790.1	4e-60	homeobox 51

Link Out ? help Back to Top
Phytozome	Thecc1EG022391t1
Entrez Gene	18598127

Publications ? help Back to Top
Motamayor JC, et al. The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color. Genome Biol., 2013. 14(6): p. r53 [PMID:23731509] Zhao JL, et al. Micro-trichome as a class I homeodomain-leucine zipper gene regulates multicellular trichome development in Cucumis sativus. J Integr Plant Biol, 2015. 57(11): p. 925-35 [PMID:25735194] Andres RJ, et al. Modifications to a LATE MERISTEM IDENTITY1 gene are responsible for the major leaf shapes of Upland cotton (Gossypium hirsutum L.). Proc. Natl. Acad. Sci. U.S.A., 2017. 114(1): p. E57-E66 [PMID:27999177] Vuolo F, et al. LMI1 homeodomain protein regulates organ proportions by spatial modulation of endoreduplication. Genes Dev., 2018. 32(21-22): p. 1361-1366 [PMID:30366902]