PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thecc1EG018545t2 | ||||||||
Common Name | TCM_018545 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 140aa MW: 14905.5 Da PI: 6.7397 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 104.6 | 6e-33 | 70 | 126 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY eC+kNhAa +Gg+avDGC+Efm+s geegt+aal+CaACgCHRnFHRreve+e Thecc1EG018545t2 70 SVRYGECQKNHAAGVGGYAVDGCREFMAS-GEEGTSAALTCAACGCHRNFHRREVETE 126 69**************************9.999*********************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 9.0E-26 | 66 | 136 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 1.5E-30 | 71 | 123 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 5.3E-27 | 72 | 123 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 26.276 | 73 | 122 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 140 aa Download sequence Send to blast |
RQGQLLLLAL YQSTEALSKS DNSSSALQGF GAEGGDKEEF GDRGMRKRQV VVRREEPPRS 60 TTNSSLTIRS VRYGECQKNH AAGVGGYAVD GCREFMASGE EGTSAALTCA ACGCHRNFHR 120 REVETEVVCE CSSPPSNGA* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021297644.1 | 2e-83 | mini zinc finger protein 2-like | ||||
Swissprot | Q9LJW5 | 2e-45 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | A0A061EGD2 | 5e-97 | A0A061EGD2_THECC; Mini zinc finger 2 isoform 2 (Fragment) | ||||
STRING | EOY03457 | 9e-98 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM944 | 28 | 114 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 5e-36 | mini zinc finger 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thecc1EG018545t2 |
Entrez Gene | 18601512 |
Publications ? help Back to Top | |||
---|---|---|---|
|