PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIUR3_20118-P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 148aa MW: 17004.3 Da PI: 10.6406 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 34.3 | 5.3e-11 | 53 | 101 | 7 | 55 |
HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 7 errkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 +rr NR +A+rsR RK+ +i eLe+ v +L++e +aL ++ +l + TRIUR3_20118-P1 53 TRRILANRQSAQRSRVRKLHYISELERSVTSLQTEVSALSPRVASLDHQ 101 588899*********************************9999888766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 5.8E-8 | 52 | 111 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 4.5E-10 | 53 | 103 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14703 | 5.68E-17 | 54 | 102 | No hit | No description |
PROSITE profile | PS50217 | 8.967 | 54 | 105 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.5E-10 | 54 | 105 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 54 | 69 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.3E-13 | 54 | 105 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
VAGAHEFDRL DDDQLMSMFS DELAPQRQAQ AATPPRSRQC TAPRGRILQF LYTRRILANR 60 QSAQRSRVRK LHYISELERS VTSLQTEVSA LSPRVASLDH QRSLLTLGNS HLKQRIAALA 120 QDKIFKDAHQ EALKKEIERL SQIYQQQQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription regulator. {ECO:0000250}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By white light. {ECO:0000269|PubMed:18065552}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT036821 | 1e-112 | BT036821.1 Zea mays full-length cDNA clone ZM_BFb0141B19 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020191576.1 | 1e-69 | basic leucine zipper 2-like | ||||
Swissprot | Q6K3R9 | 5e-58 | BZP19_ORYSJ; Basic leucine zipper 19 | ||||
TrEMBL | T1MQF3 | 1e-102 | T1MQF3_TRIUA; Uncharacterized protein | ||||
STRING | TRIUR3_20118-P1 | 1e-102 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1322 | 38 | 125 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G58120.1 | 4e-49 | bZIP family protein |