![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIUR3_10778-P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 170aa MW: 19042.6 Da PI: 10.3185 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 53.8 | 3.5e-17 | 8 | 57 | 41 | 90 |
TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS B3 41 esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 ++ W+++++y+++s++yvltkGW++Fvk++gL +gD v F+++ + + TRIUR3_10778-P1 8 SWESMWRFRYSYWNSSQSYVLTKGWSRFVKEKGLHAGDAVGFYRSASGNN 57 56788**************************************7655444 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 11.674 | 1 | 67 | IPR003340 | B3 DNA binding domain |
Gene3D | G3DSA:2.40.330.10 | 2.9E-20 | 5 | 71 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 1.0E-14 | 8 | 60 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 9.55E-16 | 10 | 65 | IPR015300 | DNA-binding pseudobarrel domain |
CDD | cd10017 | 2.94E-13 | 13 | 52 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MWRFRDSSWE SMWRFRYSYW NSSQSYVLTK GWSRFVKEKG LHAGDAVGFY RSASGNNQLF 60 IDCKLRSKST TTFLNAAAAP SPAPVTRTVR LFGVDLLTAL APEHEEYGMA PKTNKRSMDA 120 SVAAPTPAHA VWKKRCVDFA LTYRLATTSQ CPRSRDQVEG VQAAGSTFAL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wid_A | 3e-21 | 12 | 69 | 63 | 120 | DNA-binding protein RAV1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK371941 | 1e-147 | AK371941.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2143K20. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020159692.1 | 4e-88 | AP2/ERF and B3 domain-containing protein Os05g0549800-like | ||||
Swissprot | Q6L4H4 | 8e-44 | Y5498_ORYSJ; AP2/ERF and B3 domain-containing protein Os05g0549800 | ||||
TrEMBL | T1M046 | 1e-123 | T1M046_TRIUA; Uncharacterized protein | ||||
STRING | TRIUR3_10778-P1 | 1e-124 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP25161 | 3 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G68840.2 | 1e-27 | related to ABI3/VP1 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|