![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRAES3BF066100070CFD_t1 | ||||||||
Common Name | TRAES_3BF066100070CFD_c1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 179aa MW: 18996 Da PI: 10.7508 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 32.5 | 1.8e-10 | 88 | 131 | 2 | 45 |
XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 ke r +r+ +NR++A+ R+RKka++ eLe k+k Le N +L TRAES3BF066100070CFD_t1 88 KEQNRLKRLLRNRVSAQQARERKKAYMTELEVKAKDLELRNAEL 131 78899***********************************9887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.4E-12 | 87 | 151 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 4.0E-11 | 88 | 149 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 12.059 | 89 | 152 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.3E-16 | 92 | 151 | No hit | No description |
SuperFamily | SSF57959 | 5.38E-12 | 92 | 149 | No hit | No description |
CDD | cd14704 | 1.13E-13 | 92 | 142 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 94 | 109 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MAAQEQEQQA KTSTTSSLPS SSDRSSSSGP NNLKEGGAES DEEIRRVPEM GGGSASSGAG 60 DGKQLQLAAA GGGQAPAGKK RGRAAGDKEQ NRLKRLLRNR VSAQQARERK KAYMTELEVK 120 AKDLELRNAE LEQKVSTLQN ENNTLRQILK NTTAHAGKKP SGGKGGDSGK KHHHHFGKG |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 77 | 83 | GKKRGRA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269|PubMed:15178762}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK365648 | 0.0 | AK365648.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2035O05. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020188760.1 | 3e-71 | transcription factor HY5-like | ||||
Swissprot | Q9SM50 | 7e-44 | HY5_SOLLC; Transcription factor HY5 | ||||
TrEMBL | A0A077RQT7 | 1e-123 | A0A077RQT7_WHEAT; Uncharacterized protein | ||||
STRING | BRADI2G04590.1 | 6e-68 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1408 | 38 | 111 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G11260.1 | 4e-29 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|