PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

MYB

Protein Properties

Length: 267aa MW: 29124.1 Da PI: 8.8062

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
TRAES3BF044400110CFD_t1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	52.4	1.2e-16	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+ ++k +G g+W++ ++ g+ R++k+c++rw +yl TRAES3BF044400110CFD_t1 14 KGAWTKEEDQRLIGYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNYL 61 79****************************99**********97 PP
2	Myb_DNA-binding	54.4	3e-17	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T ++del+++++++lG++ W++Ia ++ gRt++++k++w+++ TRAES3BF044400110CFD_t1 67 RGNFTDDDDELIIKLHALLGNK-WSLIAGQLP-GRTDNEIKNYWNTH 111 89******************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.7E-23	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	16.089	9	61	IPR017930	Myb domain
SMART	SM00717	1.7E-12	13	63	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.35E-28	13	108	IPR009057	Homeodomain-like
Pfam	PF00249	5.8E-15	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	7.30E-11	16	61	No hit	No description
PROSITE profile	PS51294	27.647	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	6.8E-27	65	116	IPR009057	Homeodomain-like
SMART	SM00717	4.0E-16	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	3.2E-15	67	111	IPR001005	SANT/Myb domain
CDD	cd00167	1.95E-12	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 267 aa Download sequence Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIGYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWMNY 60 LRPDLKRGNF TDDDDELIIK LHALLGNKWS LIAGQLPGRT DNEIKNYWNT HIKRKLLNRG 120 MDPHTHCPIS AASGLTTSTT APVFPSSPAP ASRLANAPFA FQSSTVSFAR PSPSDDGHSS 180 SGGSSDAPRC PDLNLDLDLD LSMSLPCSPP KTAPPAKSTP TSHQQQGICL CYHLGVRNGE 240 ACTCKTASPA GPRVFRFLRP LEEGQYI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-29	14	116	7	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JF951911	0.0	JF951911.1 Triticum aestivum clone TaMYB28 R2R3-MYB protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020200984.1	1e-172	myb-related protein 308-like
Swissprot	P81393	9e-91	MYB08_ANTMA; Myb-related protein 308
Swissprot	Q9SZP1	2e-90	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	A0A077S5D9	0.0	A0A077S5D9_WHEAT; Uncharacterized protein
TrEMBL	A0A446Q7F3	0.0	A0A446Q7F3_TRITD; Uncharacterized protein
STRING	TRIUR3_22555-P1	1e-173	(Triticum urartu)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP116	37	448

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38620.1	3e-85	myb domain protein 4

Publications ? help Back to Top
Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C Expression patterns of myb genes from Antirrhinum flowers. Plant Cell, 1991. 3(2): p. 115-25 [PMID:1840903] Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]