PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRAES3BF004600020CFD_t1 | ||||||||
Common Name | TRAES_3BF004600020CFD_c1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 183aa MW: 19207.3 Da PI: 6.6739 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 171 | 1.4e-53 | 40 | 135 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 +eqdr+lPianv+rimk+vlP nak+sk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa++ lGf+dyv+p++ yl TRAES3BF004600020CFD_t1 40 KEQDRLLPIANVGRIMKQVLPPNAKVSKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWAFSALGFDDYVDPMRRYL 125 89************************************************************************************ PP NF-YB 88 kkyrelegek 97 k+releg++ TRAES3BF004600020CFD_t1 126 LKFRELEGDR 135 ********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.8E-49 | 36 | 140 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.26E-37 | 42 | 139 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.2E-26 | 45 | 108 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.5E-17 | 73 | 91 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 76 | 92 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.5E-17 | 92 | 110 | No hit | No description |
PRINTS | PR00615 | 4.5E-17 | 111 | 129 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 183 aa Download sequence Send to blast |
MADHHYTHLG GGSGSGGGGG GGSPPERLHG GGGSGDQGIK EQDRLLPIAN VGRIMKQVLP 60 PNAKVSKEAK ETMQECVSEF ISFVTGEASD KCHKEKRKTV NGDDVCWAFS ALGFDDYVDP 120 MRRYLLKFRE LEGDRAAAAA SSRGGLPVPD ASTSGAGASG SGNFMFEAMD RRDNTGPGTG 180 RQF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 4e-43 | 39 | 130 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 4e-43 | 39 | 130 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 12 | 22 | SGSGGGGGGGS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG670306 | 0.0 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020196188.1 | 1e-105 | nuclear transcription factor Y subunit B-1-like | ||||
Swissprot | O82248 | 4e-55 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A077RSD1 | 1e-131 | A0A077RSD1_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A446QCI8 | 1e-131 | A0A446QCI8_TRITD; Uncharacterized protein | ||||
STRING | MLOC_7755.1 | 1e-100 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 5e-56 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|