PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Spipo3G0015500

Organism

Spirodela polyrhiza

Taxonomic ID

29656

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela

Family

ZF-HD

Protein Properties

Length: 89aa MW: 9592.69 Da PI: 8.8004

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Spipo3G0015500	genome	MIPS/IBIS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	103.2	1.7e-32	19	75	2	59
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 + vrY eC+kNhAa++GghavDGC+Efmp+ g egta al+CaAC CHR+FHRreve+ Spipo3G0015500 19 RVVRYAECRKNHAARIGGHAVDGCREFMPA-GGEGTAGALQCAACSCHRSFHRREVED 75 579************************9.8899******************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	4.0E-17	21	69	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	1.0E-29	21	73	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	1.3E-26	22	73	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.345	23	72	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 89 aa Download sequence Send to blast
MGPQQEPGKH QRSSAARKRV VRYAECRKNH AARIGGHAVD GCREFMPAGG EGTAGALQCA 60 ACSCHRSFHR REVEDDVLRD RSSDSATL*

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, such as ZHD5, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by preventing the expression of genes involved in gibberellic acid (GA), auxin and brassinosteroid signaling and by promoting the expression of abscisic acid (ABA)-responsive genes. Regulates several development aspects, including photomorphogenesis, apical dominance, longevity, flower morphology and fertility, as well as root and stem elongation. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269\|PubMed:16412086, ECO:0000269\|PubMed:21059647, ECO:0000269\|PubMed:21455630}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010246148.1	5e-33	PREDICTED: mini zinc finger protein 2-like
Swissprot	Q9CA51	2e-26	MIF1_ARATH; Mini zinc finger protein 1
TrEMBL	A0A1U7YZP3	1e-31	A0A1U7YZP3_NELNU; mini zinc finger protein 2-like
STRING	XP_010246148.1	2e-32	(Nelumbo nucifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1431	34	120

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G74660.1	1e-24	mini zinc finger 1

Link Out ? help Back to Top
Phytozome	Spipo3G0015500